Haloarcula marismortui: rrnAC0003 Help Entry rrnAC0003         CDS       T00211                                  Name (GenBank) unknown   KO K22568   acetyl-CoA/propionyl-CoA carboxylase, PccX subunit [EC:6.4.1.2 6.4.1.3] Organism hma  Haloarcula marismortui Pathway hma00280   Valine, leucine and isoleucine degradation hma00630   Glyoxylate and dicarboxylate metabolism hma00640   Propanoate metabolism hma01100   Metabolic pathways hma01110   Biosynthesis of secondary metabolites hma01120   Microbial metabolism in diverse environments hma01200   Carbon metabolism Module hma_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:hma00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     rrnAC0003    00640 Propanoate metabolism     rrnAC0003   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     rrnAC0003 Enzymes [BR:hma01000]  6. Ligases   6.4  Forming carbon-carbon bonds    6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)     6.4.1.2  acetyl-CoA carboxylase      rrnAC0003     6.4.1.3  propionyl-CoA carboxylase      rrnAC0003 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  AAV45089 UniProt:  Q5V5W3 LinkDB All DBs Position I:complement(3009..3314) Genome browser AA seq 101 aa AA seqDB search MAADTDSAVDADLVAEIAAQLDDASTAEAAAIAVAIGAHLTDRQRAAAAAAAAAAADDGD SWDGRQWSFSGRVEATQKRSVRVRSDAPTDPWSAAGRAERF NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcggctgacactgactcggctgtcgatgcagatctggtcgcagaaatcgccgcccaa ctcgacgacgcgtcgacggccgaagcggctgctatcgccgtcgctatcggcgcacacctc accgaccgccagcgtgcggcagcagcggccgcggcggctgcggcggcagacgacggtgac tcctgggacggcagacagtggtcgttctccgggcgcgttgaagccacgcagaagcggtcc gttcgggttcgctcggacgcgccgaccgacccctggagcgctgccggccgcgccgaacgg ttctaa

DBGET integrated database retrieval system