Haloarcula marismortui ATCC 43049: rrnB0205
Help
Entry
rrnB0205 CDS
T00211
Symbol
livH-8
Name
(GenBank) branched-chain amino acid ABC transporter permease protein
KO
K01997
branched-chain amino acid transport system permease protein
Organism
hma
Haloarcula marismortui ATCC 43049
Pathway
hma02010
ABC transporters
hma02024
Quorum sensing
Brite
KEGG Orthology (KO) [BR:
hma00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
rrnB0205 (livH-8)
09140 Cellular Processes
09145 Cellular community - prokaryotes
02024 Quorum sensing
rrnB0205 (livH-8)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
hma02000
]
rrnB0205 (livH-8)
Transporters [BR:
hma02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Branched-chain amino acid transporter
rrnB0205 (livH-8)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
BPD_transp_2
Motif
Other DBs
NCBI-ProteinID:
AAV48388
UniProt:
Q5UWG5
LinkDB
All DBs
Position
II:complement(167643..168740)
Genome browser
AA seq
365 aa
AA seq
DB search
MAARDYYSRGQNLVYNRPVLVIFAVIGVFLVFDILRQVGTGTVAITDLMSYLWNGLVLGM
SLGLAGVGLSMTYSILNFANFAHGDLITSGAFAGWATAFLIAGLGEFSVESLILIGGPIA
VGSNELGINVVNTPLALLAGLLVAAVLTAALSLLLDRIVFRPMRSADGVTLMIASVGVAL
FLRNFLTYSFLTDSRGLTGGNVPQFTVAGVTFGGHQITLVVVAALLMLGTHILLQYTKIG
TAMRAMAANKDLAKVTGIPTERVVKLTWIIGGGLTGCAGFLIALQQGTLTVTMGWDLLLL
VFAAVILGGVGSIYGAMVGGVILGLASRLALVWIPASFLLVAAFVIMIVMLLVRPSGLFS
GRTTA
NT seq
1098 nt
NT seq
+upstream
nt +downstream
nt
atggcggcacgagactactacagccgtggacagaatctggtatacaaccgcccagtactc
gttatattcgcagttatcggcgtgtttctcgtattcgatattcttcgacaggtaggcact
ggaacagttgccatcacagacctcatgagttatctctggaacggactggtgctgggcatg
tcgcttggactggccggtgtcggcctctcgatgacatacagtatcctcaatttcgcgaac
tttgcccacggtgacttgattacgagcggtgcgttcgccggatgggcgacggcgtttctg
attgccgggctgggagagttctctgtcgaatcgctcattcttatcggcggcccaatcgca
gtcggttcgaatgagcttggcatcaatgttgtcaataccccgctggcgcttctggctggc
ttactcgtcgctgcggttctgacagccgccctttcgctcttgctggatcgaatcgtgttc
agaccgatgcgcagcgctgacggtgtgaccttgatgattgccagcgtcggcgtcgcgctg
ttcctccggaatttcctcacctattcgtttctgactgacagccgtgggctgacaggcggc
aacgtcccccagtttactgttgcgggcgtcacgttcgggggacaccagattacgctggtc
gtcgtcgccgcgctcctgatgcttgggactcacattctgctccagtacaccaaaatcggc
accgcgatgcgtgcaatggctgcgaacaaggacctcgcaaaagtcacgggcatcccaacg
gagcgcgttgtcaaactcacgtggattatcggcggcgggcttaccgggtgtgcaggcttt
cttatcgcactacagcaggggacgctcacagtgacaatggggtgggacctgctgttactg
gtgttcgcagcggtcatcctcggcggtgtcgggtcgatctacggcgcaatggtcggcggt
gtcattctcggtctcgcgagtcgactcgcgctcgtctggattccagccagcttccttctg
gttgcggcgttcgttatcatgatcgtcatgctgctcgtgcgtccatcggggctgttcagt
gggaggacgacggcatga
DBGET
integrated database retrieval system