Haloarcula marismortui ATCC 43049: rrnB0263
Help
Entry
rrnB0263 CDS
T00211
Symbol
accC1
Name
(GenBank) carbamoyl phosphate synthase L chain
KO
K11263
acetyl-CoA/propionyl-CoA/long-chain acyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:
6.4.1.2
6.4.1.3
6.4.1.-
6.3.4.14
]
Organism
hma
Haloarcula marismortui ATCC 43049
Pathway
hma00061
Fatty acid biosynthesis
hma00280
Valine, leucine and isoleucine degradation
hma00620
Pyruvate metabolism
hma00630
Glyoxylate and dicarboxylate metabolism
hma00640
Propanoate metabolism
hma01100
Metabolic pathways
hma01110
Biosynthesis of secondary metabolites
hma01120
Microbial metabolism in diverse environments
hma01200
Carbon metabolism
hma01212
Fatty acid metabolism
Module
hma_M00741
Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:
hma00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00620 Pyruvate metabolism
rrnB0263 (accC1)
00630 Glyoxylate and dicarboxylate metabolism
rrnB0263 (accC1)
00640 Propanoate metabolism
rrnB0263 (accC1)
09103 Lipid metabolism
00061 Fatty acid biosynthesis
rrnB0263 (accC1)
09105 Amino acid metabolism
00280 Valine, leucine and isoleucine degradation
rrnB0263 (accC1)
Enzymes [BR:
hma01000
]
6. Ligases
6.3 Forming carbon-nitrogen bonds
6.3.4 Other carbon-nitrogen ligases
6.3.4.14 biotin carboxylase
rrnB0263 (accC1)
6.4 Forming carbon-carbon bonds
6.4.1 Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
6.4.1.2 acetyl-CoA carboxylase
rrnB0263 (accC1)
6.4.1.3 propionyl-CoA carboxylase
rrnB0263 (accC1)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CPSase_L_D2
Biotin_carb_N
Biotin_carb_C
Biotin_lipoyl
ATP-grasp
Dala_Dala_lig_C
GARS_A
Biotin_lipoyl_2
ATP-grasp_3
ATP-grasp_5
ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID:
AAV48434
UniProt:
Q5UWB9
LinkDB
All DBs
Position
II:complement(216960..218744)
Genome browser
AA seq
594 aa
AA seq
DB search
MFEKVLVANRGEIAVRVMAACEELGIETVAVYSDADRNAGHVEYADDAYNVGPAPASESY
LDQTAILDVAERAGADAIHPGYGFLAENAEFAGRVEAADGLTWVGPPSDAMETLGEKTKA
RTVMQEAGVPVVPGTTDLVSEPDEVRELGAKYGYPIAIKAEGGGGGRGMKIVRSEAEVAE
ALKSAKREGEAYFGNDSVYVEKYLEAPKHVEVQVLADEHGNVRHLGERDCSLQRRHQKVI
EEAPSPALDAELRTEIGAAARRGVSEAGYTNAGTVEFLVEDGEFYFMEVNTRIQVEHTVT
EAVTGIDIVRWQLRVAAGERLDFTQDDVSIDGHAVEYRINAENPAEDFAPTPGPLTTYAP
PSSIGVRLDHAVSQGDDIGGDYDSMIAKLIVAGEDREHCLDRSKRALDHFTVEGVHTTIP
FHRLMLDDDTFRAGTHTTKYLDQELADDALDAAVARWGTDEVGGDASAASTDQIAVEVDG
KRFDVVVTDGLPRISRDGNASGGSGSGTSGGNSSGGGTVDVTTSGAITAEMQGTILSTKV
VPGDDIAAGDVVCVLEAMKMENDVVASAGGTVASVPVAEGDSVDMGDTLVVLEE
NT seq
1785 nt
NT seq
+upstream
nt +downstream
nt
atgttcgagaaagtccttgtcgcaaaccgcggcgaaatcgcggttcgtgtgatggctgcg
tgtgaagagttgggtatcgagacggtcgccgtctacagcgacgccgaccgcaacgccggc
cacgttgagtacgccgacgacgcatacaacgtcggcccggcacctgcaagcgagtcgtac
ctcgaccagaccgctatccttgatgtcgctgagcgggccggggccgacgcaatccacccc
gggtacggcttcctcgccgaaaacgctgagttcgctggccgcgtcgaagccgctgacggt
ctcacctgggtcggcccgccaagcgacgcgatggaaacgctgggcgaaaagacgaaagcc
cggacggtgatgcaggaggctggtgtcccagtcgtccccggcacgacggacctggtcagt
gagccggacgaagtgcgcgaactgggtgccaagtacggctaccccatcgcaatcaaggct
gaaggcggcggtggcggtcgtggcatgaagatcgttcggagcgaggccgaagttgcggag
gcgctcaaaagcgcaaaacgcgagggggaagcgtatttcggcaatgactcggtgtacgtc
gaaaagtatctcgaagccccaaagcacgtcgaagtgcaggtgcttgcggacgaacacggt
aatgtccgccacctcggcgagcgcgattgctcgctgcaacgtcgccaccagaaagtcatc
gaggaagccccgagtccagcgcttgacgccgaactgcgtacggagatcggggcggccgcc
agacgcggtgtcagtgaagccgggtacacgaacgccgggaccgtggagttcctcgtcgaa
gacggggaattctatttcatggaggtgaacacccgaattcaggtcgaacacaccgtcact
gaagcagtgaccgggatcgatatcgttcgctggcagctccgggtcgctgcaggcgagcga
ctggactttacacaggacgacgtgtcgatagacgggcacgccgtcgagtaccggatcaac
gcggagaacccggcggaagacttcgcgccgacgccagggccgctaacgacgtacgcgccg
ccaagcagtatcggtgtccggctcgaccacgcggtctcccagggcgacgacatcgggggc
gactacgactcgatgatcgcgaagctcatcgtcgctggcgaggaccgggagcactgtctg
gaccggtcaaagcgtgctctcgaccatttcactgtcgagggggtccataccactatcccg
ttccatcggttgatgctggatgacgacaccttccgcgccgggacgcatacaacaaaatac
ctcgaccaggaactcgccgacgatgccctcgacgcggctgttgcacgatgggggactgac
gaggtcggtggcgacgcctcggcggcgtcgacggatcaaatcgctgtcgaagtcgatggg
aagcgcttcgatgtcgtcgttacggacggactgccccgcatctcccgtgatggcaacgcc
agtggcggctccggcagtggcacttcgggcggcaactcatccggtggcggcacggtggac
gtgaccacgtcgggtgcgattacggccgagatgcagggcactattctttcgactaaagtt
gtacccggtgacgatattgctgcgggcgatgtcgtctgcgtgctggaggcgatgaaaatg
gaaaacgacgtggtggcatctgcgggcggcactgttgcatctgtcccggtcgcagagggc
gattccgtagacatgggtgacaccctggttgtactggaggaataa
DBGET
integrated database retrieval system