Hydrogenovibrio marinus: HVMH_0353
Help
Entry
HVMH_0353 CDS
T06677
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
hmar
Hydrogenovibrio marinus
Pathway
hmar03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
hmar00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
HVMH_0353 (rplR)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
hmar03011
]
HVMH_0353 (rplR)
Ribosome [BR:
hmar03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
HVMH_0353 (rplR)
Bacteria
HVMH_0353 (rplR)
Archaea
HVMH_0353 (rplR)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
TM1506
DUF7712
Motif
Other DBs
NCBI-ProteinID:
BBN58759
LinkDB
All DBs
Position
386282..386647
Genome browser
AA seq
121 aa
AA seq
DB search
MGKDMDKKTTRLRRAKKIRAKVSAQKVARLCVHRTPKHIYAQIISADGTTVIAASSTVQA
DIKKEVGFGGNKDAAKIVGKSIAEKAKAAGIESVAFDRSGFKYHGRIQELADSARENGLQ
F
NT seq
366 nt
NT seq
+upstream
nt +downstream
nt
ttgggaaaagatatggataagaaaactacccgactacgtagagctaaaaagattagagca
aaagtgtctgcacagaaagtggctcgtttgtgcgtacatcgcacacctaagcacatttat
gctcaaattatttctgcagacggtactaccgttattgctgctagctcaacagtacaagcg
gatattaaaaaagaagttggttttggtggaaataaagatgctgccaaaatcgttggtaag
tctattgctgaaaaagcaaaagcggcaggtattgagtctgttgcatttgatagatctgga
tttaaataccacggtcgtattcaggaactagcagattcagcccgtgaaaacggtcttcaa
ttttaa
DBGET
integrated database retrieval system