Hydrogenovibrio marinus: HVMH_0375 Help Entry HVMH_0375         CDS       T06677                                  Symbol groS Name (GenBank) 10 kDa chaperonin   KO K04078   chaperonin GroES Organism hmar  Hydrogenovibrio marinus Brite KEGG Orthology (KO) [BR:hmar00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:hmar03110]     HVMH_0375 (groS)    03029 Mitochondrial biogenesis [BR:hmar03029]     HVMH_0375 (groS) Chaperones and folding catalysts [BR:hmar03110]  Heat shock proteins   HSP10    HVMH_0375 (groS) Mitochondrial biogenesis [BR:hmar03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     HVMH_0375 (groS) SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 DUF7205 Motif Other DBs NCBI-ProteinID:  BBN58781 LinkDB All DBs Position 404860..405150 Genome browser AA seq 96 aa AA seqDB search MNIKPLHDRVVVRQVEEQKESAGGILLPGSAQEKENRGEVVAVGPGKAADNGSIIPMTVK VGDKVLFGQYSGQEVKDDNGQALKVMREDDIIAIID NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaatatcaaacctttgcatgatcgcgttgtagttcgccaagttgaagagcagaaagaa tctgctggtggtattttgctaccaggttctgcacaagaaaaagaaaatcgtggtgaagtt gttgcggttggtccaggtaaggctgcggataacggttctattatccctatgactgtgaag gtaggcgacaaagtgctttttggccaatactctggtcaagaagtaaaagatgacaacggt caagcgctgaaagtaatgcgtgaagacgacatcatcgccatcattgattaa

DBGET integrated database retrieval system