Hydrogenovibrio marinus: HVMH_2255 Help Entry HVMH_2255         CDS       T06677                                  Name (GenBank) hypothetical protein   KO K03060   DNA-directed RNA polymerase subunit omega [EC:2.7.7.6] Organism hmar  Hydrogenovibrio marinus Pathway hmar03020   RNA polymerase Brite KEGG Orthology (KO) [BR:hmar00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     HVMH_2255  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:hmar03021]     HVMH_2255    03400 DNA repair and recombination proteins [BR:hmar03400]     HVMH_2255 Enzymes [BR:hmar01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.6  DNA-directed RNA polymerase      HVMH_2255 Transcription machinery [BR:hmar03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      HVMH_2255 DNA repair and recombination proteins [BR:hmar03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       HVMH_2255 SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-ProteinID:  BBN60661 LinkDB All DBs Position 2421046..2421270 Genome browser AA seq 74 aa AA seqDB search MARVTVEDCLDQVENRFELVILGAKRARQLSNGAEPTLEWDKDKPTVMALRELAENTIDK DVVMSDPDTPPYFG NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggctcgtgtaacagtagaagactgcttagaccaagttgaaaatcgttttgaattggtt atcttgggtgcaaaacgcgctcgtcaactttctaacggtgcagaaccgactttagagtgg gataaagacaagcctaccgtcatggcacttcgcgaactagcggaaaacaccattgacaaa gatgtggttatgtctgatccagatacccctccttacttcggttaa

DBGET integrated database retrieval system