Hominenteromicrobium mulieris: ACI0CA_12720 Help Entry ACI0CA_12720      CDS       T10961                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism hmb  Hominenteromicrobium mulieris Pathway hmb00020   Citrate cycle (TCA cycle) hmb00720   Other carbon fixation pathways hmb01100   Metabolic pathways hmb01110   Biosynthesis of secondary metabolites hmb01120   Microbial metabolism in diverse environments hmb01200   Carbon metabolism hmb01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:hmb00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     ACI0CA_12720   09102 Energy metabolism    00720 Other carbon fixation pathways     ACI0CA_12720 Enzymes [BR:hmb01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      ACI0CA_12720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_9 Fer4_10 Fer4_2 Fer4_21 Fer4_16 Fer4_22 Fer4_6 Fer4_15 Fer4_3 Fer4_4 Fer4_13 Fer4_17 Motif Other DBs NCBI-ProteinID:  XLS22255 LinkDB All DBs Position complement(2551693..2551899) Genome browser AA seq 68 aa AA seqDB search MARIIVDEKVCKGCSMCIHACPKKIIALAKDRLNAKGYHPAELTDEAACVGCAACATMCP DSAITVER NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggcaaggatcattgtagacgaaaaagtatgtaaaggctgctccatgtgcattcacgcg tgtccgaaaaagatcatcgcgctcgcgaaggatcgtttgaacgcgaagggctatcacccc gcagagctgaccgatgaggcagcgtgcgtgggctgtgcggcatgcgcgactatgtgcccg gattcggcgatcacggtggaacgctga

DBGET integrated database retrieval system