Vreelandella aquamarina SCSIO 43005: CTT34_11200 Help Entry CTT34_11200       CDS       T06424                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hmd  Vreelandella aquamarina SCSIO 43005 Pathway hmd01100   Metabolic pathways hmd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hmd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CTT34_11200    00074 Mycolic acid biosynthesis     CTT34_11200   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CTT34_11200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  QHD50218 UniProt:  A0A0D7UY91 LinkDB All DBs Position complement(2308006..2308239) Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNVKEEDIQNSSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAIDYVNAHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtactattgaagagcgcgtaaagaaagtagtggcagagcgcctgaacgttaaagaa gaagacatccagaacagctcttctttcactgaagacctgggtgccgactctctggacacc gttgaattggtgatggcgttggaagaggaattcgacaccgaaattcctgatgaagaagct gagaaaatcactacggttcaagaagcgatcgactacgtcaacgcccaccagtaa

DBGET integrated database retrieval system