Haloferax mediterranei: HFX_2479 Help Entry HFX_2479          CDS       T02129                                  Name (GenBank) hypothetical protein   KO K22568   acetyl-CoA/propionyl-CoA carboxylase, PccX subunit [EC:6.4.1.2 6.4.1.3] Organism hme  Haloferax mediterranei Pathway hme00280   Valine, leucine and isoleucine degradation hme00630   Glyoxylate and dicarboxylate metabolism hme00640   Propanoate metabolism hme01100   Metabolic pathways hme01110   Biosynthesis of secondary metabolites hme01120   Microbial metabolism in diverse environments hme01200   Carbon metabolism Module hme_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:hme00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     HFX_2479    00640 Propanoate metabolism     HFX_2479   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     HFX_2479 Enzymes [BR:hme01000]  6. Ligases   6.4  Forming carbon-carbon bonds    6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)     6.4.1.2  acetyl-CoA carboxylase      HFX_2479     6.4.1.3  propionyl-CoA carboxylase      HFX_2479 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Herpes_UL56 OAD_gamma Motif Other DBs NCBI-ProteinID:  AFK20162 UniProt:  I3R7F2 A0A4P8P730 LinkDB All DBs Position complement(2162453..2162719) Genome browser AA seq 88 aa AA seqDB search MTEDLLSGLSIPDDADSEEAAAIAAAVGAHLHDQTAAAVAAAADEEETWDEKRWQYAGRL DSVTGCARRVPSGAPTNAWAASGRTDRF NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgacggaggacctgctctcggggctgtcgattcccgacgacgcggactcggaggaggca gcggccatcgctgctgcagtcggcgcacatctccacgaccagacggccgccgcggtcgcc gccgcagcagacgaagaagagacgtgggacgaaaagcgctggcagtacgccggtcgcctc gactcggttacgggatgcgcccgtcgcgtcccgtcgggcgcaccaacgaacgcgtgggcc gcttcgggacgtactgaccggttctga

DBGET integrated database retrieval system