Hydra vulgaris (swiftwater hydra): 100198637 Help Entry 100198637         CDS       T01080                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism hmg  Hydra vulgaris (swiftwater hydra) Pathway hmg04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:hmg00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     100198637  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:hmg04121]     100198637    03400 DNA repair and recombination proteins [BR:hmg03400]     100198637 Ubiquitin system [BR:hmg04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      100198637    Cul5 complex      100198637 DNA repair and recombination proteins [BR:hmg03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      100198637 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD DUF7953 Astacin Motif Other DBs NCBI-GeneID:  100198637 NCBI-ProteinID:  XP_002157137 LinkDB All DBs Position 10:complement(29895991..29913565) Genome browser AA seq 114 aa AA seqDB search MEVFLVIKREKTSIFLDVKETTYVYEIKSTLATLLKKNTDDMCLLYKDSILDENKTVAEY GLTMQTTKPQTPALIGLVYRISEMDFEELNIIPVSLPNELPGTMKPQDSPAAGS NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atggaggttttccttgtgatcaaacgtgaaaaaacatcaatttttctggatgttaaggaa acaacatatgtgtatgaaataaagtcaacactagcaacacttttaaagaagaacactgat gatatgtgtttgctttacaaagatagtatattagatgaaaataaaactgttgcagagtat gggttaacaatgcaaactactaaacctcaaactcctgcattgattggtcttgtttataga atatcagaaatggattttgaagaattaaatatcatccctgtatcattaccaaatgaatta ccaggtacaatgaagcctcaagattcacctgctgctggttcatag

DBGET integrated database retrieval system