Hydra vulgaris (swiftwater hydra): 100200557 Help Entry 100200557         CDS       T01080                                  Name (RefSeq) cystatin-A1   KO K13907   cystatin-A/B Organism hmg  Hydra vulgaris (swiftwater hydra) Brite KEGG Orthology (KO) [BR:hmg00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:hmg01002]     100200557   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hmg04147]     100200557 Peptidases and inhibitors [BR:hmg01002]  Peptidase inhibitors   Family I25: cystatin family    100200557 Exosome [BR:hmg04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    100200557 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Pgp3_helical AAA_lid_NAV1 Ribosomal_S7 Motif Other DBs NCBI-GeneID:  100200557 NCBI-ProteinID:  XP_002158618 UniProt:  T2MHW6 LinkDB All DBs Position 3:4563975..4564701 Genome browser AA seq 99 aa AA seqDB search MSMPGGTTAMKDATDEVQHIIEKVKDQVLGKVNDALENYKAISFKTQVVAGVNYFIKVDI GNDRYIHLKVFRPLPFDNEKFELHSVQEHKSKEDELKYF NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgtccatgcctggtggaacaaccgcaatgaaagatgcaaccgacgaagttcagcatatt attgaaaaggtaaaagaccaagtattaggcaaagttaacgatgcgttagaaaattataaa gctatttcattcaaaacacaagttgtagctggagttaactactttataaaggtggatatt ggtaacgacagatatattcatttaaaagtgttccgtcctttaccttttgataacgaaaag tttgaattacacagtgttcaagaacataaatctaaagaggacgaattaaaatatttctaa

DBGET integrated database retrieval system