Hydra vulgaris (swiftwater hydra): 100207713 Help Entry 100207713         CDS       T01080                                  Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism hmg  Hydra vulgaris (swiftwater hydra) Pathway hmg03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:hmg00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     100207713  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hmg03036]     100207713    03400 DNA repair and recombination proteins [BR:hmg03400]     100207713 Chromosome and associated proteins [BR:hmg03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      100207713 DNA repair and recombination proteins [BR:hmg03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      100207713 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C Histone CBFD_NFYB_HMF Bromo_TP TFIID-18kDa Motif Other DBs NCBI-GeneID:  100207713 NCBI-ProteinID:  XP_002159515 UniProt:  T2M9S6 LinkDB All DBs Position 10:complement(16387241..16387851) Genome browser AA seq 110 aa AA seqDB search MAETNEDNEKSQLKAALHYAVGKICEMKSDEHNVTYSKAFIACLTETVANEVELFATDLE AFAKHAKRTTINIEDVKLLVRRNPGLAEEIETCSKSLLEKHKPKIKKIKS NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggctgaaactaatgaagataatgaaaaatcacaattaaaggctgctctacattatgct gtagggaagatatgtgaaatgaagtctgatgaacataatgtgacatattctaaagctttt atagcttgtttgacagaaaccgttgcaaatgaagtagaattatttgcaactgatcttgaa gcatttgccaagcatgctaaaagaacaactataaatattgaagatgtaaagttattagtg cgcagaaatccaggacttgctgaggagattgaaacatgctctaaatcactattagaaaaa cataagccaaaaattaaaaaaataaagtcgtga

DBGET integrated database retrieval system