Hydra vulgaris (swiftwater hydra): 100210294 Help Entry 100210294         CDS       T01080                                  Name (RefSeq) dynein axonemal light chain 4   KO K10412   dynein axonemal light chain 4 Organism hmg  Hydra vulgaris (swiftwater hydra) Pathway hmg04814   Motor proteins Brite KEGG Orthology (KO) [BR:hmg00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     100210294  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:hmg03037]     100210294    04812 Cytoskeleton proteins [BR:hmg04812]     100210294 Cilium and associated proteins [BR:hmg03037]  Motile cilia and associated proteins   Dynein arm    100210294 Cytoskeleton proteins [BR:hmg04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      100210294 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Swm2 Rif1_N Motif Other DBs NCBI-GeneID:  100210294 NCBI-ProteinID:  XP_002162246 UniProt:  T2MHJ9 LinkDB All DBs Position 11:complement(14737174..14742335) Genome browser AA seq 109 aa AA seqDB search MTEAKEEVAVPRDFYDYKRLHSYPLIKHSDMNEEMRAEAMELCVTACEKFQSNNEAAAKM IKESLDKKFGSPWHCVVGESYGYEITHELKNLLYMFFAGSLAVTVWKCS NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgaccgaagcgaaagaagaggttgctgttccaagagacttttatgattacaagcgctta cacagttatcctttaataaagcactcagatatgaatgaagaaatgcgtgctgaggcaatg gagttgtgtgttacagcttgtgaaaagtttcaaagcaataatgaggctgccgctaaaatg atcaaagaaagtttagataaaaagtttggatctccttggcattgtgttgtcggagagagc tacgggtatgaaattactcatgaacttaaaaatttactttacatgttttttgcaggatct ttggctgtaacagtgtggaagtgttcataa

DBGET integrated database retrieval system