Hydra vulgaris (swiftwater hydra): 100213235 Help Entry 100213235         CDS       T01080                                  Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism hmg  Hydra vulgaris (swiftwater hydra) Pathway hmg03030   DNA replication hmg03082   ATP-dependent chromatin remodeling hmg03410   Base excision repair hmg03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:hmg00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     100213235    03410 Base excision repair     100213235    03420 Nucleotide excision repair     100213235   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100213235  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:hmg03032]     100213235    03036 Chromosome and associated proteins [BR:hmg03036]     100213235    03400 DNA repair and recombination proteins [BR:hmg03400]     100213235 Enzymes [BR:hmg01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      100213235 DNA replication proteins [BR:hmg03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     100213235 Chromosome and associated proteins [BR:hmg03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     100213235 DNA repair and recombination proteins [BR:hmg03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       100213235 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone TAF Motif Other DBs NCBI-GeneID:  100213235 NCBI-ProteinID:  XP_047134433 LinkDB All DBs Position 6:19719319..19729766 Genome browser AA seq 134 aa AA seqDB search MAEKPEDLNLPSAVIARMIKEVLPDGVNISKEARAAISKSASVFVLYATSCANNIALKRK RKTLTASDVLEAIDEMEFSSFLEPLKEALENFKVGQREKKGAADLKRKQKAEIESEEKKK KEEGTETSIEYLIL NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atggctgaaaaacctgaggatttaaatcttccttctgcagttattgcaagaatgattaaa gaagtgcttccagatggtgtaaatatttctaaagaagctcgtgctgctataagtaaatct gcaagtgtgtttgtcctttacgctacttcatgtgcaaacaatattgctctcaaaaggaaa cgaaaaacgcttaccgccagtgatgttttggaagctattgatgaaatggagttttccagt tttctcgaacctctaaaagaagcattagaaaatttcaaagttggtcagagagaaaagaaa ggggcagcagatttgaaacgcaaacaaaaagcagaaattgaaagtgaagaaaaaaagaaa aaagaagaaggcacagaaacttcaattgaatatttgatattataa

DBGET integrated database retrieval system