Hydra vulgaris (swiftwater hydra): 105849760 Help Entry 105849760         CDS       T01080                                  Name (RefSeq) ras-like GTP-binding protein RHO   KO K04513   Ras homolog gene family, member A Organism hmg  Hydra vulgaris (swiftwater hydra) Pathway hmg04081   Hormone signaling hmg04144   Endocytosis hmg04150   mTOR signaling pathway hmg04310   Wnt signaling pathway hmg04350   TGF-beta signaling pathway hmg04517   IgSF CAM signaling hmg04519   Cadherin signaling hmg05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:hmg00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     105849760    04350 TGF-beta signaling pathway     105849760    04150 mTOR signaling pathway     105849760   09133 Signaling molecules and interaction    04081 Hormone signaling     105849760    04517 IgSF CAM signaling     105849760    04519 Cadherin signaling     105849760  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105849760  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     105849760  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hmg04131]     105849760   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hmg04147]     105849760    04031 GTP-binding proteins [BR:hmg04031]     105849760 Membrane trafficking [BR:hmg04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     105849760 Exosome [BR:hmg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105849760   Exosomal proteins of other body fluids (saliva and urine)    105849760   Exosomal proteins of colorectal cancer cells    105849760   Exosomal proteins of bladder cancer cells    105849760 GTP-binding proteins [BR:hmg04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     105849760 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase SRPRB MMR_HSR1 ABC_tran Motif Other DBs NCBI-GeneID:  105849760 NCBI-ProteinID:  XP_047138078 LinkDB All DBs Position 8:complement(19215268..19242613) Genome browser AA seq 211 aa AA seqDB search MHINSNKNQMKSSERSPVHRKKLVIVGDGACGKTSLLYVFTKDIMPAGYVPTIFDNYVAD MEVDNKQVELALFDTAGQEEYDQLRILMYPNTDVVIICYSIDNPDSLINVLQKWTPEVKH YCPGVPIILCGNKKDLRNNDDLKRDLEDINKKPLTLEEGLLASEKIDAKGFIECSALTKA GVMSLFETAARHSMKKKITKYKQIKQICSII NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atgcatataaattcaaataaaaatcaaatgaaatcatcagagagaagccctgttcataga aaaaaattagttatagttggagatggcgcatgtggaaaaacaagtttgttatatgtattc acaaaagatataatgccagctggttatgttcctacaatttttgataactatgtggctgat atggaggttgataataaacaagtagaattagcactttttgacacagctgggcaggaggag tatgaccagttaagaatacttatgtacccaaatactgatgttgttatcatttgttacagt attgacaatccagatagcctcataaatgtcttacaaaaatggactccagaagttaagcat tattgccctggtgtaccaataatactttgtggaaacaaaaaagacttgagaaataacgac gatttaaagcgtgacctcgaagatatcaacaaaaaacctcttactttagaagaaggactg ttagcatcagaaaaaattgatgccaaaggttttattgaatgttcagcattaacaaaagct ggagttatgtctttatttgagactgctgctcgtcattcaatgaagaaaaaaataacaaag tataagcaaataaagcaaatatgtagtataatatag

DBGET integrated database retrieval system