Hylobates moloch (silvery gibbon): 116456646 Help Entry 116456646         CDS       T08803                                  Symbol MYL5 Name (RefSeq) myosin light chain 5   KO K12753   myosin regulatory light chain 5 Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04360   Axon guidance hmh04510   Focal adhesion hmh04520   Adherens junction hmh04670   Leukocyte transendothelial migration hmh04810   Regulation of actin cytoskeleton hmh04814   Motor proteins hmh04820   Cytoskeleton in muscle cells hmh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hmh00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     116456646 (MYL5)    04520 Adherens junction     116456646 (MYL5)   09142 Cell motility    04814 Motor proteins     116456646 (MYL5)    04820 Cytoskeleton in muscle cells     116456646 (MYL5)    04810 Regulation of actin cytoskeleton     116456646 (MYL5)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     116456646 (MYL5)   09158 Development and regeneration    04360 Axon guidance     116456646 (MYL5)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116456646 (MYL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hmh04812]     116456646 (MYL5) Cytoskeleton proteins [BR:hmh04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      116456646 (MYL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 EF_EFCAB10_C EH EFhand_Ca_insen AIF-1 Caleosin Lipoprotein_6 Motif Other DBs NCBI-GeneID:  116456646 NCBI-ProteinID:  XP_031991280 LinkDB All DBs Position Unknown AA seq 173 aa AA seqDB search MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYA SLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKI NKEYIKRLLMSQADKMTADEVDQMFQFASIDAAGNLDYKALSYVITHGEEKEE NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atggccagcaggaagaccaagaagaaggaagggggtgccctccgggcccagagagcctca tccaatgtcttctccaacttcgagcagactcagatccaggagttcaaggaggcattcaca ctcatggatcagaaccgagatggcttcattgacaaggaggacctgaaggacacctacgcc tccctgggcaagaccaacgtcaaggacgacgagctggacgccatgctcaaagaggcctca ggacccatcaacttcaccatgtttctgaacctgtttggggagaagctgagcggtacggat gccgaggagaccattctaaacgccttcaagatgctggacccggacgggaaagggaaaatc aacaaggagtacatcaagcgtctgctgatgtcccaggctgacaagatgacggcggatgag gtggaccagatgttccagttcgcctccatcgacgcggcgggcaacctggactacaaggcg ctcagctacgtgatcacccacggggaggagaaggaggagtga

DBGET integrated database retrieval system