Hylobates moloch (silvery gibbon): 116457363 Help Entry 116457363         CDS       T08803                                  Symbol JUN Name (RefSeq) transcription factor Jun   KO K04448   transcription factor AP-1 Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh01522   Endocrine resistance hmh04010   MAPK signaling pathway hmh04012   ErbB signaling pathway hmh04024   cAMP signaling pathway hmh04137   Mitophagy - animal hmh04210   Apoptosis hmh04310   Wnt signaling pathway hmh04380   Osteoclast differentiation hmh04510   Focal adhesion hmh04530   Tight junction hmh04620   Toll-like receptor signaling pathway hmh04621   NOD-like receptor signaling pathway hmh04625   C-type lectin receptor signaling pathway hmh04657   IL-17 signaling pathway hmh04658   Th1 and Th2 cell differentiation hmh04659   Th17 cell differentiation hmh04660   T cell receptor signaling pathway hmh04662   B cell receptor signaling pathway hmh04668   TNF signaling pathway hmh04722   Neurotrophin signaling pathway hmh04912   GnRH signaling pathway hmh04915   Estrogen signaling pathway hmh04921   Oxytocin signaling pathway hmh04926   Relaxin signaling pathway hmh04932   Non-alcoholic fatty liver disease hmh04933   AGE-RAGE signaling pathway in diabetic complications hmh05030   Cocaine addiction hmh05031   Amphetamine addiction hmh05132   Salmonella infection hmh05133   Pertussis hmh05135   Yersinia infection hmh05140   Leishmaniasis hmh05142   Chagas disease hmh05161   Hepatitis B hmh05162   Measles hmh05166   Human T-cell leukemia virus 1 infection hmh05167   Kaposi sarcoma-associated herpesvirus infection hmh05169   Epstein-Barr virus infection hmh05170   Human immunodeficiency virus 1 infection hmh05171   Coronavirus disease - COVID-19 hmh05200   Pathways in cancer hmh05203   Viral carcinogenesis hmh05207   Chemical carcinogenesis - receptor activation hmh05208   Chemical carcinogenesis - reactive oxygen species hmh05210   Colorectal cancer hmh05211   Renal cell carcinoma hmh05224   Breast cancer hmh05231   Choline metabolism in cancer hmh05235   PD-L1 expression and PD-1 checkpoint pathway in cancer hmh05321   Inflammatory bowel disease hmh05323   Rheumatoid arthritis hmh05417   Lipid and atherosclerosis hmh05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116457363 (JUN)    04012 ErbB signaling pathway     116457363 (JUN)    04310 Wnt signaling pathway     116457363 (JUN)    04668 TNF signaling pathway     116457363 (JUN)    04024 cAMP signaling pathway     116457363 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     116457363 (JUN)   09143 Cell growth and death    04210 Apoptosis     116457363 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     116457363 (JUN)    04530 Tight junction     116457363 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     116457363 (JUN)    04621 NOD-like receptor signaling pathway     116457363 (JUN)    04625 C-type lectin receptor signaling pathway     116457363 (JUN)    04660 T cell receptor signaling pathway     116457363 (JUN)    04658 Th1 and Th2 cell differentiation     116457363 (JUN)    04659 Th17 cell differentiation     116457363 (JUN)    04657 IL-17 signaling pathway     116457363 (JUN)    04662 B cell receptor signaling pathway     116457363 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     116457363 (JUN)    04915 Estrogen signaling pathway     116457363 (JUN)    04921 Oxytocin signaling pathway     116457363 (JUN)    04926 Relaxin signaling pathway     116457363 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     116457363 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     116457363 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116457363 (JUN)    05207 Chemical carcinogenesis - receptor activation     116457363 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     116457363 (JUN)    05203 Viral carcinogenesis     116457363 (JUN)    05231 Choline metabolism in cancer     116457363 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     116457363 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     116457363 (JUN)    05211 Renal cell carcinoma     116457363 (JUN)    05224 Breast cancer     116457363 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     116457363 (JUN)    05170 Human immunodeficiency virus 1 infection     116457363 (JUN)    05161 Hepatitis B     116457363 (JUN)    05171 Coronavirus disease - COVID-19     116457363 (JUN)    05162 Measles     116457363 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     116457363 (JUN)    05169 Epstein-Barr virus infection     116457363 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     116457363 (JUN)    05135 Yersinia infection     116457363 (JUN)    05133 Pertussis     116457363 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     116457363 (JUN)    05142 Chagas disease     116457363 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     116457363 (JUN)    05321 Inflammatory bowel disease     116457363 (JUN)   09165 Substance dependence    05030 Cocaine addiction     116457363 (JUN)    05031 Amphetamine addiction     116457363 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116457363 (JUN)    05418 Fluid shear stress and atherosclerosis     116457363 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     116457363 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     116457363 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     116457363 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:hmh03000]     116457363 (JUN) Transcription factors [BR:hmh03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     116457363 (JUN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 ZapB PspA_IM30 Fib_alpha DUF3450 TFIIA FlaC_arch Motif Other DBs NCBI-GeneID:  116457363 NCBI-ProteinID:  XP_031992415 LinkDB All DBs Position Unknown AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctatgacgatgccctcaacgcctcgttcctcccg tccgagagcggaccttatggctacagtaaccccaagatcctgaaacagagcatgaccctg aacctggccgacccagtggggagcctgaagccgcacctccgcgccaagaactcggacctc ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcttgata atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc aagaacgtgacagacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcaacggggcg ggcatggtggctcccgcggtagcctcggtggcagggggcagcggcagcggcggcttcagc gccagcttgcacagcgagccgccggtctacgccaacctcagcaacttcaacccaggcgcg ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcaa ccccagcagcagcagcagccgccgcagccgccgcaccacctgccccagcagatgcccgtg cagcacccgcggctgcaggccctgaaggaggagcctcagacggtgcccgagatgcctggc gagacaccgcccctgtcccccatcgacatggagtcccaggagcggatcaaggcggagagg aagcgcatgaggaaccgcatcgctgcctccaagtgccgaaaaaggaagctggagagaatc gcccggctggaggaaaaagtgaaaaccttgaaagctcagaactcggagctggcgtccacg gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac agtgggtgccaactcatgctaacgcagcagttgcaaacattttga

DBGET integrated database retrieval system