Hylobates moloch (silvery gibbon): 116458332 Help Entry 116458332         CDS       T08803                                  Name (RefSeq) interferon alpha-2   KO K05414   interferon alpha Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04060   Cytokine-cytokine receptor interaction hmh04151   PI3K-Akt signaling pathway hmh04217   Necroptosis hmh04620   Toll-like receptor signaling pathway hmh04621   NOD-like receptor signaling pathway hmh04622   RIG-I-like receptor signaling pathway hmh04623   Cytosolic DNA-sensing pathway hmh04630   JAK-STAT signaling pathway hmh04650   Natural killer cell mediated cytotoxicity hmh04936   Alcoholic liver disease hmh05152   Tuberculosis hmh05160   Hepatitis C hmh05161   Hepatitis B hmh05162   Measles hmh05163   Human cytomegalovirus infection hmh05164   Influenza A hmh05165   Human papillomavirus infection hmh05167   Kaposi sarcoma-associated herpesvirus infection hmh05168   Herpes simplex virus 1 infection hmh05169   Epstein-Barr virus infection hmh05170   Human immunodeficiency virus 1 infection hmh05171   Coronavirus disease - COVID-19 hmh05200   Pathways in cancer hmh05320   Autoimmune thyroid disease hmh05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     116458332    04151 PI3K-Akt signaling pathway     116458332   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116458332  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     116458332  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     116458332    04621 NOD-like receptor signaling pathway     116458332    04622 RIG-I-like receptor signaling pathway     116458332    04623 Cytosolic DNA-sensing pathway     116458332    04650 Natural killer cell mediated cytotoxicity     116458332  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116458332   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     116458332    05161 Hepatitis B     116458332    05160 Hepatitis C     116458332    05171 Coronavirus disease - COVID-19     116458332    05164 Influenza A     116458332    05162 Measles     116458332    05168 Herpes simplex virus 1 infection     116458332    05163 Human cytomegalovirus infection     116458332    05167 Kaposi sarcoma-associated herpesvirus infection     116458332    05169 Epstein-Barr virus infection     116458332    05165 Human papillomavirus infection     116458332   09171 Infectious disease: bacterial    05152 Tuberculosis     116458332   09163 Immune disease    05320 Autoimmune thyroid disease     116458332   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116458332   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     116458332  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hmh04052]     116458332 Cytokines and neuropeptides [BR:hmh04052]  Cytokines   Interferons    116458332 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon iSTAND CoV_NSP2_N Motif Other DBs NCBI-GeneID:  116458332 NCBI-ProteinID:  XP_031993854 LinkDB All DBs Position Unknown AA seq 188 aa AA seqDB search MALTFALLVALLVLSCKSSCSLGCDLPQTHSMGNRRTLMLLAQMRRISPFSCLKDRHDFG FPQEEFGNQFQKAQTIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEA CVMQEVGVTETPLMKEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNL QERLRRKE NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atggccttgacctttgctttactggtggccctcttggtgctcagctgcaagtcaagctgc tctctgggctgtgatctgcctcaaacccacagcatgggtaacaggaggaccttgatgctc ctggcacaaatgaggagaatctctcctttctcctgcttgaaggacagacatgactttgga tttccccaggaggagtttggcaaccagttccaaaaggctcaaaccatccctgtcctccat gagatgatccagcagatcttcaatctcttcagcacaaaggactcatctgctgcttgggat gagaccctcctagacaaattctacactgaactctaccagcagctgaatgacctggaagcc tgtgtgatgcaggaggtgggggtgacagagactcccctgatgaaggaggactccattctg gctgtgaggaaatacttccaaagaatcactctctatctgacagagaagaaatacagccct tgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttatcaacaaacttg caagaaagattaaggaggaaggaatga

DBGET integrated database retrieval system