Hylobates moloch (silvery gibbon): 116460497 Help Entry 116460497         CDS       T08803                                  Name (RefSeq) glutathione S-transferase A1   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh00480   Glutathione metabolism hmh00980   Metabolism of xenobiotics by cytochrome P450 hmh00982   Drug metabolism - cytochrome P450 hmh00983   Drug metabolism - other enzymes hmh01100   Metabolic pathways hmh01524   Platinum drug resistance hmh05200   Pathways in cancer hmh05204   Chemical carcinogenesis - DNA adducts hmh05207   Chemical carcinogenesis - receptor activation hmh05208   Chemical carcinogenesis - reactive oxygen species hmh05225   Hepatocellular carcinoma hmh05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hmh00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     116460497   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     116460497    00982 Drug metabolism - cytochrome P450     116460497    00983 Drug metabolism - other enzymes     116460497  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116460497    05204 Chemical carcinogenesis - DNA adducts     116460497    05207 Chemical carcinogenesis - receptor activation     116460497    05208 Chemical carcinogenesis - reactive oxygen species     116460497   09162 Cancer: specific types    05225 Hepatocellular carcinoma     116460497   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     116460497   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     116460497  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:hmh02000]     116460497 Enzymes [BR:hmh01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      116460497 Transporters [BR:hmh02000]  Other transporters   Pores ion channels [TC:1]    116460497 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C GST_C_3 GST_N GST_N_3 GST_N_2 Motif Other DBs NCBI-GeneID:  116460497 NCBI-ProteinID:  XP_031997637 LinkDB All DBs Position Unknown AA seq 222 aa AA seqDB search MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKLLKSAEDLDKLRNDGYLMFQQVPMVEI DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGVADLGEMILLLPICPPEEKDAK LASIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVEVLYYVEELDSSLISSFPL LKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atggcagagaagcccaaactccactacttcaatgcacggggcagaatggagtccacccgg tggctcctggctgcagctggagtagagtttgaagagaaacttctaaaatctgcagaagat ttggacaagttaagaaatgatggatatttgatgttccagcaagtaccaatggttgagatt gatgggatgaagctggtgcagaccagagccattctcaactacattgccagcaaatacaac ctctacgggaaagacataaaggagagagccctgattgatatgtatatagaaggtgtagca gatttgggtgaaatgatcctccttctgcccatatgtccacctgaggaaaaagatgccaaa cttgcctccatcaaagagaaaataaaaaatcgctacttccctgcctttgaaaaagtctta aagagccacggacaagactaccttgttggcaacaagctgagccgggctgacattcatctg gtggaagttctctactacgtcgaggagcttgactccagtcttatctccagcttccctctg ctgaaggccctgaaaaccagaatcagcaacctgcccacggtgaagaagtttctgcagcct ggcagcccaaggaagcctcccatggatgagaaatctttagaagaagcaaggaagattttc aggttttaa

DBGET integrated database retrieval system