Hylobates moloch (silvery gibbon): 116461353 Help Entry 116461353         CDS       T08803                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh01521   EGFR tyrosine kinase inhibitor resistance hmh01524   Platinum drug resistance hmh04014   Ras signaling pathway hmh04064   NF-kappa B signaling pathway hmh04115   p53 signaling pathway hmh04137   Mitophagy - animal hmh04140   Autophagy - animal hmh04151   PI3K-Akt signaling pathway hmh04210   Apoptosis hmh04215   Apoptosis - multiple species hmh04621   NOD-like receptor signaling pathway hmh04630   JAK-STAT signaling pathway hmh05012   Parkinson disease hmh05014   Amyotrophic lateral sclerosis hmh05022   Pathways of neurodegeneration - multiple diseases hmh05145   Toxoplasmosis hmh05162   Measles hmh05166   Human T-cell leukemia virus 1 infection hmh05168   Herpes simplex virus 1 infection hmh05170   Human immunodeficiency virus 1 infection hmh05200   Pathways in cancer hmh05202   Transcriptional misregulation in cancer hmh05212   Pancreatic cancer hmh05220   Chronic myeloid leukemia hmh05222   Small cell lung cancer hmh05225   Hepatocellular carcinoma hmh05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     116461353 (BCL2L1)    04630 JAK-STAT signaling pathway     116461353 (BCL2L1)    04064 NF-kappa B signaling pathway     116461353 (BCL2L1)    04151 PI3K-Akt signaling pathway     116461353 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     116461353 (BCL2L1)    04137 Mitophagy - animal     116461353 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     116461353 (BCL2L1)    04215 Apoptosis - multiple species     116461353 (BCL2L1)    04115 p53 signaling pathway     116461353 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     116461353 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116461353 (BCL2L1)    05202 Transcriptional misregulation in cancer     116461353 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     116461353 (BCL2L1)    05225 Hepatocellular carcinoma     116461353 (BCL2L1)    05220 Chronic myeloid leukemia     116461353 (BCL2L1)    05222 Small cell lung cancer     116461353 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     116461353 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     116461353 (BCL2L1)    05162 Measles     116461353 (BCL2L1)    05168 Herpes simplex virus 1 infection     116461353 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     116461353 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     116461353 (BCL2L1)    05014 Amyotrophic lateral sclerosis     116461353 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     116461353 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116461353 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     116461353 (BCL2L1)    01524 Platinum drug resistance     116461353 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:hmh01009]     116461353 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hmh03036]     116461353 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:hmh02000]     116461353 (BCL2L1) Protein phosphatases and associated proteins [BR:hmh01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      116461353 (BCL2L1) Chromosome and associated proteins [BR:hmh03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     116461353 (BCL2L1) Transporters [BR:hmh02000]  Other transporters   Pores ion channels [TC:1]    116461353 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  116461353 NCBI-ProteinID:  XP_031998904 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacaggactgaggccccagaaggg actgaatcggagatggagacccccagtgccatcaatggcaacccatcctggcacctggcg gacagccccgcggtgaatggagccactggccacagcagcagtttggatgcccgggaggtg atccccatggcagcagtaaagcaagcgctgagggaggcaggcgacgagtttgaactgcgg taccggcgggcattcagtgacctgacatcccagctccacatcaccccagggacagcatat cagagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatt gtggcctttttctccttcggcggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggattgcagcttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggatacttttgtggaactctatgggaacaatgcagca gccgagagccgaaagggccaggaacgcttcaaccgctggttcctgacgggcatgactgtg gccggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system