Hylobates moloch (silvery gibbon): 116462586 Help Entry 116462586         CDS       T08803                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04066   HIF-1 signaling pathway hmh04120   Ubiquitin mediated proteolysis hmh05170   Human immunodeficiency virus 1 infection hmh05200   Pathways in cancer hmh05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:hmh00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     116462586 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     116462586 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116462586 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     116462586 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     116462586 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:hmh04121]     116462586 (ELOB)    03400 DNA repair and recombination proteins [BR:hmh03400]     116462586 (ELOB) Ubiquitin system [BR:hmh04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      116462586 (ELOB)    Cul5 complex      116462586 (ELOB) DNA repair and recombination proteins [BR:hmh03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      116462586 (ELOB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  116462586 NCBI-ProteinID:  XP_032001105 LinkDB All DBs Position Unknown AA seq 145 aa AA seqDB search MLDHARAAGNGAERGCAGASRGEAAAAMDVFLMIRRHKTTIFTDAKESSTVFELKRIVEG ILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPF SSPPELPDVMKPQDSGSSANEQAVQ NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgctggaccacgcgcgggctgccgggaacggggcggagcgcggctgcgccggcgcgtcg aggggagaggcagccgccgcgatggacgtgttcctcatgatccggcgccacaagaccacc atcttcacggacgccaaggagtccagcacggtgttcgaactgaagcgcatcgtcgagggc atcctcaagcggcctcctgacgagcagcggctgtacaaggatgaccaactcttggatgat ggcaagacactgggcgagtgtggcttcaccagtcaaacagcacggccacaggccccagcc acagtggggctggccttccgggcagatgacacctttgaggccctgtgcatcgagccgttt tccagcccgcccgagctgcccgatgtgatgaagccccaggactcgggaagcagtgccaat gaacaagccgtgcagtga

DBGET integrated database retrieval system