Hylobates moloch (silvery gibbon): 116465944 Help Entry 116465944         CDS       T08803                                  Name (RefSeq) histone H3.Y-like   KO K11253   histone H3 Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04613   Neutrophil extracellular trap formation hmh05034   Alcoholism hmh05202   Transcriptional misregulation in cancer hmh05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:hmh00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     116465944  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     116465944   09163 Immune disease    05322 Systemic lupus erythematosus     116465944   09165 Substance dependence    05034 Alcoholism     116465944  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hmh03036]     116465944   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hmh04147]     116465944 Chromosome and associated proteins [BR:hmh03036]  Eukaryotic type   Nucleosome assembly factors    Histones     116465944 Exosome [BR:hmh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116465944 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  116465944 NCBI-ProteinID:  XP_032004730 LinkDB All DBs Position Unknown AA seq 141 aa AA seqDB search MVSTKQSPHKATTWQDSRKPLATKASGKRAPPTGGIKKPHRYRPGTLALRKIRKYQKSTQ LLLRKLPFQGLVREIAQAISPNLRFQSAAIGALHEASEAYLVQLFKDANLCAIHARRVTI MPRDMQLAGASAERVLKSPGS NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atggtgagcaccaagcagtccccgcacaaagccaccacctggcaggactccaggaagccc ctggccaccaaagcctccggcaagagggcgccgcctacaggagggatcaaaaagcctcac cgctacaggcctggcaccctggcgctgcgcaaaatcagaaagtaccagaagtccactcag ttgctcctgcgcaagctgcctttccagggcctggtgcgcgagattgcccaggccatcagc cccaacctgcgcttccagagtgcggccattggcgccctacatgaggccagcgaggcctac ctggtgcaactcttcaaagacgccaacctgtgtgccatccatgccaggcgtgtcacaatc atgcccagagacatgcagctggccggcgcctccgcagagagggtgcttaagagcccaggc tcctag

DBGET integrated database retrieval system