Hylobates moloch (silvery gibbon): 116466301 Help Entry 116466301         CDS       T08803                                  Name (RefSeq) metallothionein-2-like   KO K14739   metallothionein 1/2 Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04978   Mineral absorption Brite KEGG Orthology (KO) [BR:hmh00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     116466301  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:hmh03019]     116466301    03029 Mitochondrial biogenesis [BR:hmh03029]     116466301 Messenger RNA biogenesis [BR:hmh03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      116466301 Mitochondrial biogenesis [BR:hmh03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     116466301 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  116466301 NCBI-ProteinID:  XP_032004998 LinkDB All DBs Position Unknown AA seq 61 aa AA seqDB search MDPNCSCVAGVSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASGKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgcgtcgctggtgtctcctgtgcctgcgctggctcctgcaag tgcaaagagtgcaaatgcacctcctgcaagaagagctgctgctcctgctgccctgtgggc tgtgccaaatgtgcccagggctgcatttgcaaaggggcatcagggaagtgcagctgctgc gcctga

DBGET integrated database retrieval system