Hylobates moloch (silvery gibbon): 116466686 Help Entry 116466686         CDS       T08803                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04621   NOD-like receptor signaling pathway hmh05012   Parkinson disease hmh05132   Salmonella infection hmh05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hmh00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     116466686  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116466686   09164 Neurodegenerative disease    05012 Parkinson disease     116466686   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     116466686  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:hmh03110]     116466686 Chaperones and folding catalysts [BR:hmh03110]  Protein folding catalysts   Protein disulfide isomerase    116466686 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 Thioredoxin_7 Thioredoxin_8 Glutaredoxin OST3_OST6 DIM1 Redoxin Motif Other DBs NCBI-GeneID:  116466686 NCBI-ProteinID:  XP_032609773 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MVKQIKSKVAFQEALDTTGNKLVVDFSATWCGPCKMIKSFFHSLSGKYSNVVFLEVDVDD CQDVALECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggtaaaacagatcaagagcaaggttgcttttcaggaagccttggacaccacaggcaat aaacttgtagttgacttctcagccacatggtgtgggccttgcaaaatgatcaagtctttc tttcattccctctctggaaagtattccaacgtggtattccttgaagtagatgtggatgac tgtcaggatgttgctttagagtgtgaagtcaaatgcatgccaacattccagtttttcaag aagggacaaaaggtgggtgaattttctggggccaataaggaaaagcttgaagccaccatt aatgaattagtctaa

DBGET integrated database retrieval system