Hylobates moloch (silvery gibbon): 116466870 Help Entry 116466870         CDS       T08803                                  Symbol CSTA Name (RefSeq) cystatin-A   KO K13907   cystatin-A/B Organism hmh  Hylobates moloch (silvery gibbon) Brite KEGG Orthology (KO) [BR:hmh00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:hmh01002]     116466870 (CSTA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hmh04147]     116466870 (CSTA) Peptidases and inhibitors [BR:hmh01002]  Peptidase inhibitors   Family I25: cystatin family    116466870 (CSTA) Exosome [BR:hmh04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    116466870 (CSTA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin SQAPI Afaf DAHP_snth_FXD Motif Other DBs NCBI-GeneID:  116466870 NCBI-ProteinID:  XP_032005920 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MVPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYEKLEAVEYKTQVVAGTNYYIKVRAG DNNYMHLKVFKSLPGQNEDLVLSGYQADRNKDDELTGF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggtacctggaggcttatctgaggccaaacccgccactccagaaatccaggagattgtt gataaggttaaaccacagcttgaagaaaaaacaaatgagacttacgaaaaattggaagcc gtggagtataaaacccaagtcgttgctggaacaaattactacattaaggtacgagcaggt gataataattatatgcacttgaaagtattcaaaagtcttcccggacaaaatgaagacttg gtactttctggataccaggctgacagaaacaaggacgatgagctgacaggcttttag

DBGET integrated database retrieval system