KEGG   Hylobates moloch (silvery gibbon): 116466871
Entry
116466871         CDS       T08803                                 
Name
(RefSeq) calmodulin-1-like
  KO
K02183  calmodulin
Organism
hmh  Hylobates moloch (silvery gibbon)
Pathway
hmh04014  Ras signaling pathway
hmh04015  Rap1 signaling pathway
hmh04020  Calcium signaling pathway
hmh04022  cGMP-PKG signaling pathway
hmh04024  cAMP signaling pathway
hmh04070  Phosphatidylinositol signaling system
hmh04114  Oocyte meiosis
hmh04218  Cellular senescence
hmh04261  Adrenergic signaling in cardiomyocytes
hmh04270  Vascular smooth muscle contraction
hmh04371  Apelin signaling pathway
hmh04625  C-type lectin receptor signaling pathway
hmh04713  Circadian entrainment
hmh04720  Long-term potentiation
hmh04722  Neurotrophin signaling pathway
hmh04728  Dopaminergic synapse
hmh04740  Olfactory transduction
hmh04744  Phototransduction
hmh04750  Inflammatory mediator regulation of TRP channels
hmh04910  Insulin signaling pathway
hmh04912  GnRH signaling pathway
hmh04915  Estrogen signaling pathway
hmh04916  Melanogenesis
hmh04921  Oxytocin signaling pathway
hmh04922  Glucagon signaling pathway
hmh04924  Renin secretion
hmh04925  Aldosterone synthesis and secretion
hmh04970  Salivary secretion
hmh04971  Gastric acid secretion
hmh05010  Alzheimer disease
hmh05012  Parkinson disease
hmh05022  Pathways of neurodegeneration - multiple diseases
hmh05031  Amphetamine addiction
hmh05034  Alcoholism
hmh05133  Pertussis
hmh05152  Tuberculosis
hmh05163  Human cytomegalovirus infection
hmh05167  Kaposi sarcoma-associated herpesvirus infection
hmh05170  Human immunodeficiency virus 1 infection
hmh05200  Pathways in cancer
hmh05214  Glioma
hmh05417  Lipid and atherosclerosis
hmh05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hmh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    116466871
   04015 Rap1 signaling pathway
    116466871
   04371 Apelin signaling pathway
    116466871
   04020 Calcium signaling pathway
    116466871
   04070 Phosphatidylinositol signaling system
    116466871
   04024 cAMP signaling pathway
    116466871
   04022 cGMP-PKG signaling pathway
    116466871
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    116466871
   04218 Cellular senescence
    116466871
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    116466871
  09152 Endocrine system
   04910 Insulin signaling pathway
    116466871
   04922 Glucagon signaling pathway
    116466871
   04912 GnRH signaling pathway
    116466871
   04915 Estrogen signaling pathway
    116466871
   04921 Oxytocin signaling pathway
    116466871
   04916 Melanogenesis
    116466871
   04924 Renin secretion
    116466871
   04925 Aldosterone synthesis and secretion
    116466871
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    116466871
   04270 Vascular smooth muscle contraction
    116466871
  09154 Digestive system
   04970 Salivary secretion
    116466871
   04971 Gastric acid secretion
    116466871
  09156 Nervous system
   04728 Dopaminergic synapse
    116466871
   04720 Long-term potentiation
    116466871
   04722 Neurotrophin signaling pathway
    116466871
  09157 Sensory system
   04744 Phototransduction
    116466871
   04740 Olfactory transduction
    116466871
   04750 Inflammatory mediator regulation of TRP channels
    116466871
  09159 Environmental adaptation
   04713 Circadian entrainment
    116466871
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116466871
  09162 Cancer: specific types
   05214 Glioma
    116466871
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    116466871
   05163 Human cytomegalovirus infection
    116466871
   05167 Kaposi sarcoma-associated herpesvirus infection
    116466871
  09171 Infectious disease: bacterial
   05133 Pertussis
    116466871
   05152 Tuberculosis
    116466871
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    116466871
   05012 Parkinson disease
    116466871
   05022 Pathways of neurodegeneration - multiple diseases
    116466871
  09165 Substance dependence
   05031 Amphetamine addiction
    116466871
   05034 Alcoholism
    116466871
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    116466871
   05418 Fluid shear stress and atherosclerosis
    116466871
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hmh01009]
    116466871
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hmh04131]
    116466871
   03036 Chromosome and associated proteins [BR:hmh03036]
    116466871
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hmh04147]
    116466871
Protein phosphatases and associated proteins [BR:hmh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     116466871
Membrane trafficking [BR:hmh04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    116466871
Chromosome and associated proteins [BR:hmh03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     116466871
Exosome [BR:hmh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   116466871
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 EH Allatotropin-like_C EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 EF_SSP120 UPF0154 SAPC2_N EF-hand_EFHB_C EFhand_Ca_insen Dockerin_1 DUF5580_M Caleosin FCaBP_EF-hand DUF1103 BamM_C TerB EF-hand_STIM1 SurA_N_3 PA_Ig-like
Other DBs
NCBI-GeneID: 116466871
NCBI-ProteinID: XP_032005921
LinkDB
Position
Unknown
AA seq 149 aa
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFFTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRPVMTNLGEKLTDE
EVDEMIREADIDGDGQVNYEEFVQMMTAK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggctgatcagctgaccgaagaacagattgctgaattcaaggaagctttctccctattt
gataaagatggcgatggcaccatcacaacaaaggaacttggaactgtcatgaggtcactg
ggtcagaacccaacagaagctgaattgcaggatatgatcaacgaagtggatgctgatggt
aatggcaccattgacttccctgaattttttactatgatggctagaaaaatgaaagacaca
gatagtgaagaagaaatccgtgaggcattccgagtctttgacaaggatggcaatggttat
atcagtgcagcagaactacgtcccgtcatgacaaacttaggagaaaaactaacagatgaa
gaagtagatgaaatgatcagagaagcagatattgatggagacggacaagtcaactatgaa
gaattcgtacagatgatgactgcaaaatga

DBGET integrated database retrieval system