Hylobates moloch (silvery gibbon): 116466995 Help Entry 116466995         CDS       T08803                                  Symbol PF4 Name (RefSeq) platelet factor 4   KO K05407   platelet factor 4 Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04060   Cytokine-cytokine receptor interaction hmh04061   Viral protein interaction with cytokine and cytokine receptor hmh04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116466995 (PF4)    04061 Viral protein interaction with cytokine and cytokine receptor     116466995 (PF4)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     116466995 (PF4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hmh04052]     116466995 (PF4)    00536 Glycosaminoglycan binding proteins [BR:hmh00536]     116466995 (PF4) Cytokines and neuropeptides [BR:hmh04052]  Cytokines   Chemokines    116466995 (PF4) Glycosaminoglycan binding proteins [BR:hmh00536]  Heparan sulfate / Heparin   Chemokines    116466995 (PF4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  116466995 NCBI-ProteinID:  XP_032006172 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MSSAAGFCASRPGLLFLGLLLLPAVVAFASAEAGEDGDLQCLCVKTTSQVRPRHITSLEV IKAGPHCPTAQLIATLKNGRKICLDLQVQLYKKIIKKLLESKLLAD NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgagctctgcagccgggttctgcgcctcacgcccagggctgctgtttctggggttgctg ctcctgccagctgtggtcgccttcgccagcgctgaagctggagaagatggggacctgcag tgcctgtgtgtgaaaaccacctcccaggtccgtcccaggcacatcaccagcctggaggtg atcaaggccggaccccactgccccactgcccaactgatagccacgctgaagaatgggagg aaaatttgcttggacctgcaagtccagctgtacaagaaaataattaagaaacttttggag agtaagctactagctgactaa

DBGET integrated database retrieval system