Hylobates moloch (silvery gibbon): 116467002 Help Entry 116467002         CDS       T08803                                  Symbol CXCL8 Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04060   Cytokine-cytokine receptor interaction hmh04061   Viral protein interaction with cytokine and cytokine receptor hmh04062   Chemokine signaling pathway hmh04064   NF-kappa B signaling pathway hmh04072   Phospholipase D signaling pathway hmh04218   Cellular senescence hmh04620   Toll-like receptor signaling pathway hmh04621   NOD-like receptor signaling pathway hmh04622   RIG-I-like receptor signaling pathway hmh04657   IL-17 signaling pathway hmh04932   Non-alcoholic fatty liver disease hmh04933   AGE-RAGE signaling pathway in diabetic complications hmh04936   Alcoholic liver disease hmh05132   Salmonella infection hmh05133   Pertussis hmh05134   Legionellosis hmh05135   Yersinia infection hmh05142   Chagas disease hmh05144   Malaria hmh05146   Amoebiasis hmh05161   Hepatitis B hmh05163   Human cytomegalovirus infection hmh05164   Influenza A hmh05167   Kaposi sarcoma-associated herpesvirus infection hmh05171   Coronavirus disease - COVID-19 hmh05200   Pathways in cancer hmh05202   Transcriptional misregulation in cancer hmh05219   Bladder cancer hmh05323   Rheumatoid arthritis hmh05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     116467002 (CXCL8)    04072 Phospholipase D signaling pathway     116467002 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116467002 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     116467002 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     116467002 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     116467002 (CXCL8)    04621 NOD-like receptor signaling pathway     116467002 (CXCL8)    04622 RIG-I-like receptor signaling pathway     116467002 (CXCL8)    04657 IL-17 signaling pathway     116467002 (CXCL8)    04062 Chemokine signaling pathway     116467002 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116467002 (CXCL8)    05202 Transcriptional misregulation in cancer     116467002 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     116467002 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     116467002 (CXCL8)    05171 Coronavirus disease - COVID-19     116467002 (CXCL8)    05164 Influenza A     116467002 (CXCL8)    05163 Human cytomegalovirus infection     116467002 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     116467002 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     116467002 (CXCL8)    05135 Yersinia infection     116467002 (CXCL8)    05133 Pertussis     116467002 (CXCL8)    05134 Legionellosis     116467002 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     116467002 (CXCL8)    05144 Malaria     116467002 (CXCL8)    05142 Chagas disease     116467002 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     116467002 (CXCL8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116467002 (CXCL8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     116467002 (CXCL8)    04932 Non-alcoholic fatty liver disease     116467002 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     116467002 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hmh04052]     116467002 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:hmh00536]     116467002 (CXCL8) Cytokines and neuropeptides [BR:hmh04052]  Cytokines   Chemokines    116467002 (CXCL8) Glycosaminoglycan binding proteins [BR:hmh00536]  Heparan sulfate / Heparin   Chemokines    116467002 (CXCL8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  116467002 NCBI-ProteinID:  XP_032006185 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIEAGPH CANTEIIVKLSDGRELCLDPKENWVQRVVERFLKRAENQNS NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgacttccaagctggccgtggctctcttggcagccttcctgatttctgcagctctgtgt gaaggtgcagttttgccaaggagtgctaaagaacttagatgtcagtgcataaagacgtac tccaaacctttccaccccaaatttatcaaagaactgagagtgattgaggctggaccacac tgcgctaatacagaaattattgtaaagctttccgatggaagagagctctgtctggacccc aaggaaaactgggtgcagagggttgtggagaggtttttgaagagggctgagaatcaaaat tcataa

DBGET integrated database retrieval system