Hylobates moloch (silvery gibbon): 116469568 Help Entry 116469568         CDS       T08803                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh01521   EGFR tyrosine kinase inhibitor resistance hmh01522   Endocrine resistance hmh04010   MAPK signaling pathway hmh04012   ErbB signaling pathway hmh04014   Ras signaling pathway hmh04015   Rap1 signaling pathway hmh04062   Chemokine signaling pathway hmh04068   FoxO signaling pathway hmh04071   Sphingolipid signaling pathway hmh04072   Phospholipase D signaling pathway hmh04137   Mitophagy - animal hmh04140   Autophagy - animal hmh04150   mTOR signaling pathway hmh04151   PI3K-Akt signaling pathway hmh04210   Apoptosis hmh04211   Longevity regulating pathway hmh04213   Longevity regulating pathway - multiple species hmh04218   Cellular senescence hmh04360   Axon guidance hmh04370   VEGF signaling pathway hmh04371   Apelin signaling pathway hmh04540   Gap junction hmh04550   Signaling pathways regulating pluripotency of stem cells hmh04625   C-type lectin receptor signaling pathway hmh04650   Natural killer cell mediated cytotoxicity hmh04660   T cell receptor signaling pathway hmh04662   B cell receptor signaling pathway hmh04664   Fc epsilon RI signaling pathway hmh04714   Thermogenesis hmh04720   Long-term potentiation hmh04722   Neurotrophin signaling pathway hmh04725   Cholinergic synapse hmh04726   Serotonergic synapse hmh04730   Long-term depression hmh04810   Regulation of actin cytoskeleton hmh04910   Insulin signaling pathway hmh04912   GnRH signaling pathway hmh04915   Estrogen signaling pathway hmh04916   Melanogenesis hmh04917   Prolactin signaling pathway hmh04919   Thyroid hormone signaling pathway hmh04921   Oxytocin signaling pathway hmh04926   Relaxin signaling pathway hmh04929   GnRH secretion hmh04933   AGE-RAGE signaling pathway in diabetic complications hmh04935   Growth hormone synthesis, secretion and action hmh05010   Alzheimer disease hmh05022   Pathways of neurodegeneration - multiple diseases hmh05034   Alcoholism hmh05160   Hepatitis C hmh05161   Hepatitis B hmh05163   Human cytomegalovirus infection hmh05165   Human papillomavirus infection hmh05166   Human T-cell leukemia virus 1 infection hmh05167   Kaposi sarcoma-associated herpesvirus infection hmh05170   Human immunodeficiency virus 1 infection hmh05200   Pathways in cancer hmh05203   Viral carcinogenesis hmh05205   Proteoglycans in cancer hmh05206   MicroRNAs in cancer hmh05207   Chemical carcinogenesis - receptor activation hmh05208   Chemical carcinogenesis - reactive oxygen species hmh05210   Colorectal cancer hmh05211   Renal cell carcinoma hmh05213   Endometrial cancer hmh05214   Glioma hmh05215   Prostate cancer hmh05216   Thyroid cancer hmh05218   Melanoma hmh05219   Bladder cancer hmh05220   Chronic myeloid leukemia hmh05221   Acute myeloid leukemia hmh05223   Non-small cell lung cancer hmh05224   Breast cancer hmh05225   Hepatocellular carcinoma hmh05226   Gastric cancer hmh05230   Central carbon metabolism in cancer hmh05231   Choline metabolism in cancer hmh05235   PD-L1 expression and PD-1 checkpoint pathway in cancer hmh05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116469568 (NRAS)    04012 ErbB signaling pathway     116469568 (NRAS)    04014 Ras signaling pathway     116469568 (NRAS)    04015 Rap1 signaling pathway     116469568 (NRAS)    04370 VEGF signaling pathway     116469568 (NRAS)    04371 Apelin signaling pathway     116469568 (NRAS)    04068 FoxO signaling pathway     116469568 (NRAS)    04072 Phospholipase D signaling pathway     116469568 (NRAS)    04071 Sphingolipid signaling pathway     116469568 (NRAS)    04151 PI3K-Akt signaling pathway     116469568 (NRAS)    04150 mTOR signaling pathway     116469568 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     116469568 (NRAS)    04137 Mitophagy - animal     116469568 (NRAS)   09143 Cell growth and death    04210 Apoptosis     116469568 (NRAS)    04218 Cellular senescence     116469568 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     116469568 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     116469568 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     116469568 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116469568 (NRAS)    04650 Natural killer cell mediated cytotoxicity     116469568 (NRAS)    04660 T cell receptor signaling pathway     116469568 (NRAS)    04662 B cell receptor signaling pathway     116469568 (NRAS)    04664 Fc epsilon RI signaling pathway     116469568 (NRAS)    04062 Chemokine signaling pathway     116469568 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     116469568 (NRAS)    04929 GnRH secretion     116469568 (NRAS)    04912 GnRH signaling pathway     116469568 (NRAS)    04915 Estrogen signaling pathway     116469568 (NRAS)    04917 Prolactin signaling pathway     116469568 (NRAS)    04921 Oxytocin signaling pathway     116469568 (NRAS)    04926 Relaxin signaling pathway     116469568 (NRAS)    04935 Growth hormone synthesis, secretion and action     116469568 (NRAS)    04919 Thyroid hormone signaling pathway     116469568 (NRAS)    04916 Melanogenesis     116469568 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     116469568 (NRAS)    04726 Serotonergic synapse     116469568 (NRAS)    04720 Long-term potentiation     116469568 (NRAS)    04730 Long-term depression     116469568 (NRAS)    04722 Neurotrophin signaling pathway     116469568 (NRAS)   09158 Development and regeneration    04360 Axon guidance     116469568 (NRAS)   09149 Aging    04211 Longevity regulating pathway     116469568 (NRAS)    04213 Longevity regulating pathway - multiple species     116469568 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     116469568 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116469568 (NRAS)    05206 MicroRNAs in cancer     116469568 (NRAS)    05205 Proteoglycans in cancer     116469568 (NRAS)    05207 Chemical carcinogenesis - receptor activation     116469568 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     116469568 (NRAS)    05203 Viral carcinogenesis     116469568 (NRAS)    05230 Central carbon metabolism in cancer     116469568 (NRAS)    05231 Choline metabolism in cancer     116469568 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     116469568 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     116469568 (NRAS)    05225 Hepatocellular carcinoma     116469568 (NRAS)    05226 Gastric cancer     116469568 (NRAS)    05214 Glioma     116469568 (NRAS)    05216 Thyroid cancer     116469568 (NRAS)    05221 Acute myeloid leukemia     116469568 (NRAS)    05220 Chronic myeloid leukemia     116469568 (NRAS)    05218 Melanoma     116469568 (NRAS)    05211 Renal cell carcinoma     116469568 (NRAS)    05219 Bladder cancer     116469568 (NRAS)    05215 Prostate cancer     116469568 (NRAS)    05213 Endometrial cancer     116469568 (NRAS)    05224 Breast cancer     116469568 (NRAS)    05223 Non-small cell lung cancer     116469568 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     116469568 (NRAS)    05170 Human immunodeficiency virus 1 infection     116469568 (NRAS)    05161 Hepatitis B     116469568 (NRAS)    05160 Hepatitis C     116469568 (NRAS)    05163 Human cytomegalovirus infection     116469568 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     116469568 (NRAS)    05165 Human papillomavirus infection     116469568 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     116469568 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     116469568 (NRAS)   09165 Substance dependence    05034 Alcoholism     116469568 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116469568 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     116469568 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     116469568 (NRAS)    01522 Endocrine resistance     116469568 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hmh04131]     116469568 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hmh04147]     116469568 (NRAS)    04031 GTP-binding proteins [BR:hmh04031]     116469568 (NRAS) Membrane trafficking [BR:hmh04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     116469568 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     116469568 (NRAS) Exosome [BR:hmh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116469568 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    116469568 (NRAS)   Exosomal proteins of breast cancer cells    116469568 (NRAS)   Exosomal proteins of colorectal cancer cells    116469568 (NRAS) GTP-binding proteins [BR:hmh04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     116469568 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  116469568 NCBI-ProteinID:  XP_058295419 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac agaaaacaggtggttatagatggtgaaacctgtttgttggacatactggatacagctgga caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaataatagcaagtcatttgcggatattaacctctacagggagcagatt aagcgagtaaaagactcggatgatgtacctatggtgctagtgggaaacaagtgtgatttg ccaacaaggacagttgatacaaaacaagcccacgaactggccaagagttacgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta agagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcagggt tgtatgggattgccatgtgtggtgatgtaa

DBGET integrated database retrieval system