Hylobates moloch (silvery gibbon): 116469646 Help Entry 116469646         CDS       T08803                                  Name (RefSeq) glutathione S-transferase Mu 2   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh00480   Glutathione metabolism hmh00980   Metabolism of xenobiotics by cytochrome P450 hmh00982   Drug metabolism - cytochrome P450 hmh00983   Drug metabolism - other enzymes hmh01100   Metabolic pathways hmh01524   Platinum drug resistance hmh05200   Pathways in cancer hmh05204   Chemical carcinogenesis - DNA adducts hmh05207   Chemical carcinogenesis - receptor activation hmh05208   Chemical carcinogenesis - reactive oxygen species hmh05225   Hepatocellular carcinoma hmh05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hmh00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     116469646   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     116469646    00982 Drug metabolism - cytochrome P450     116469646    00983 Drug metabolism - other enzymes     116469646  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116469646    05204 Chemical carcinogenesis - DNA adducts     116469646    05207 Chemical carcinogenesis - receptor activation     116469646    05208 Chemical carcinogenesis - reactive oxygen species     116469646   09162 Cancer: specific types    05225 Hepatocellular carcinoma     116469646   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     116469646   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     116469646  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:hmh02000]     116469646 Enzymes [BR:hmh01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      116469646 Transporters [BR:hmh02000]  Other transporters   Pores ion channels [TC:1]    116469646 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C GST_N GST_C_3 GST_C_6 GST_C_2 GST_N_3 GST_N_2 GST_C_7 Bromo_TP Motif Other DBs NCBI-GeneID:  116469646 NCBI-ProteinID:  XP_032010984 LinkDB All DBs Position Unknown AA seq 218 aa AA seqDB search MPITLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL PYLIDGTHKITQSNAILRYIARRHNLCGETEKEKIREDILENQLMDNRMQLARLCYNPDF EKLKPEYLEGLPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPN LKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgcccataacactggggtactggaacatccgtgggctggcccactccatccgcctgctc ctggaatacacagactcaagctacgaggaaaagaagtacacgatgggggatgctcctgac tatgacagaagccagtggctgaatgaaaaattcaagctgggcctggactttcccaatctg ccctacttgattgatgggactcacaagatcacccagagcaacgccatcctgcgctacatt gcccgcaggcacaacctgtgcggggagacagaaaaggagaagattcgggaagacattttg gagaaccagcttatggacaaccgtatgcagctagccagactctgctataacccagatttt gagaaactgaaaccagaatacctggagggactccctgaaatgctgaagctctactcacag tttctggggaagcagccatggtttcttggggacaagatcacgtttgtggatttcattgct tatgatgtccttgagagaaaccaagtatttgagcccagctgcctggacgccttcccaaac ctgaaggacttcatctcccgatttgagggcttggagaagatctctgcctacatgaagtcc agccgcttcctcccaagacctgtattcacaaagatggctgtctggggcaacaagtag

DBGET integrated database retrieval system