KEGG   Hylobates moloch (silvery gibbon): 116470222
Entry
116470222         CDS       T08803                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
hmh  Hylobates moloch (silvery gibbon)
Pathway
hmh01521  EGFR tyrosine kinase inhibitor resistance
hmh01522  Endocrine resistance
hmh01524  Platinum drug resistance
hmh04010  MAPK signaling pathway
hmh04012  ErbB signaling pathway
hmh04014  Ras signaling pathway
hmh04015  Rap1 signaling pathway
hmh04022  cGMP-PKG signaling pathway
hmh04024  cAMP signaling pathway
hmh04062  Chemokine signaling pathway
hmh04066  HIF-1 signaling pathway
hmh04068  FoxO signaling pathway
hmh04071  Sphingolipid signaling pathway
hmh04072  Phospholipase D signaling pathway
hmh04114  Oocyte meiosis
hmh04140  Autophagy - animal
hmh04148  Efferocytosis
hmh04150  mTOR signaling pathway
hmh04151  PI3K-Akt signaling pathway
hmh04210  Apoptosis
hmh04218  Cellular senescence
hmh04261  Adrenergic signaling in cardiomyocytes
hmh04270  Vascular smooth muscle contraction
hmh04350  TGF-beta signaling pathway
hmh04360  Axon guidance
hmh04370  VEGF signaling pathway
hmh04371  Apelin signaling pathway
hmh04380  Osteoclast differentiation
hmh04510  Focal adhesion
hmh04517  IgSF CAM signaling
hmh04520  Adherens junction
hmh04540  Gap junction
hmh04550  Signaling pathways regulating pluripotency of stem cells
hmh04611  Platelet activation
hmh04613  Neutrophil extracellular trap formation
hmh04620  Toll-like receptor signaling pathway
hmh04621  NOD-like receptor signaling pathway
hmh04625  C-type lectin receptor signaling pathway
hmh04650  Natural killer cell mediated cytotoxicity
hmh04657  IL-17 signaling pathway
hmh04658  Th1 and Th2 cell differentiation
hmh04659  Th17 cell differentiation
hmh04660  T cell receptor signaling pathway
hmh04662  B cell receptor signaling pathway
hmh04664  Fc epsilon RI signaling pathway
hmh04666  Fc gamma R-mediated phagocytosis
hmh04668  TNF signaling pathway
hmh04713  Circadian entrainment
hmh04720  Long-term potentiation
hmh04722  Neurotrophin signaling pathway
hmh04723  Retrograde endocannabinoid signaling
hmh04724  Glutamatergic synapse
hmh04725  Cholinergic synapse
hmh04726  Serotonergic synapse
hmh04730  Long-term depression
hmh04810  Regulation of actin cytoskeleton
hmh04910  Insulin signaling pathway
hmh04912  GnRH signaling pathway
hmh04914  Progesterone-mediated oocyte maturation
hmh04915  Estrogen signaling pathway
hmh04916  Melanogenesis
hmh04917  Prolactin signaling pathway
hmh04919  Thyroid hormone signaling pathway
hmh04921  Oxytocin signaling pathway
hmh04926  Relaxin signaling pathway
hmh04928  Parathyroid hormone synthesis, secretion and action
hmh04929  GnRH secretion
hmh04930  Type II diabetes mellitus
hmh04933  AGE-RAGE signaling pathway in diabetic complications
hmh04934  Cushing syndrome
hmh04935  Growth hormone synthesis, secretion and action
hmh04960  Aldosterone-regulated sodium reabsorption
hmh05010  Alzheimer disease
hmh05020  Prion disease
hmh05022  Pathways of neurodegeneration - multiple diseases
hmh05034  Alcoholism
hmh05132  Salmonella infection
hmh05133  Pertussis
hmh05135  Yersinia infection
hmh05140  Leishmaniasis
hmh05142  Chagas disease
hmh05145  Toxoplasmosis
hmh05152  Tuberculosis
hmh05160  Hepatitis C
hmh05161  Hepatitis B
hmh05163  Human cytomegalovirus infection
hmh05164  Influenza A
hmh05165  Human papillomavirus infection
hmh05166  Human T-cell leukemia virus 1 infection
hmh05167  Kaposi sarcoma-associated herpesvirus infection
hmh05170  Human immunodeficiency virus 1 infection
hmh05171  Coronavirus disease - COVID-19
hmh05200  Pathways in cancer
hmh05203  Viral carcinogenesis
hmh05205  Proteoglycans in cancer
hmh05206  MicroRNAs in cancer
hmh05207  Chemical carcinogenesis - receptor activation
hmh05208  Chemical carcinogenesis - reactive oxygen species
hmh05210  Colorectal cancer
hmh05211  Renal cell carcinoma
hmh05212  Pancreatic cancer
hmh05213  Endometrial cancer
hmh05214  Glioma
hmh05215  Prostate cancer
hmh05216  Thyroid cancer
hmh05218  Melanoma
hmh05219  Bladder cancer
hmh05220  Chronic myeloid leukemia
hmh05221  Acute myeloid leukemia
hmh05223  Non-small cell lung cancer
hmh05224  Breast cancer
hmh05225  Hepatocellular carcinoma
hmh05226  Gastric cancer
hmh05230  Central carbon metabolism in cancer
hmh05231  Choline metabolism in cancer
hmh05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hmh05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hmh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    116470222 (MAPK3)
   04012 ErbB signaling pathway
    116470222 (MAPK3)
   04014 Ras signaling pathway
    116470222 (MAPK3)
   04015 Rap1 signaling pathway
    116470222 (MAPK3)
   04350 TGF-beta signaling pathway
    116470222 (MAPK3)
   04370 VEGF signaling pathway
    116470222 (MAPK3)
   04371 Apelin signaling pathway
    116470222 (MAPK3)
   04668 TNF signaling pathway
    116470222 (MAPK3)
   04066 HIF-1 signaling pathway
    116470222 (MAPK3)
   04068 FoxO signaling pathway
    116470222 (MAPK3)
   04072 Phospholipase D signaling pathway
    116470222 (MAPK3)
   04071 Sphingolipid signaling pathway
    116470222 (MAPK3)
   04024 cAMP signaling pathway
    116470222 (MAPK3)
   04022 cGMP-PKG signaling pathway
    116470222 (MAPK3)
   04151 PI3K-Akt signaling pathway
    116470222 (MAPK3)
   04150 mTOR signaling pathway
    116470222 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    116470222 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    116470222 (MAPK3)
   04148 Efferocytosis
    116470222 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    116470222 (MAPK3)
   04210 Apoptosis
    116470222 (MAPK3)
   04218 Cellular senescence
    116470222 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    116470222 (MAPK3)
   04520 Adherens junction
    116470222 (MAPK3)
   04540 Gap junction
    116470222 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    116470222 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    116470222 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    116470222 (MAPK3)
   04613 Neutrophil extracellular trap formation
    116470222 (MAPK3)
   04620 Toll-like receptor signaling pathway
    116470222 (MAPK3)
   04621 NOD-like receptor signaling pathway
    116470222 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    116470222 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    116470222 (MAPK3)
   04660 T cell receptor signaling pathway
    116470222 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    116470222 (MAPK3)
   04659 Th17 cell differentiation
    116470222 (MAPK3)
   04657 IL-17 signaling pathway
    116470222 (MAPK3)
   04662 B cell receptor signaling pathway
    116470222 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    116470222 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    116470222 (MAPK3)
   04062 Chemokine signaling pathway
    116470222 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    116470222 (MAPK3)
   04929 GnRH secretion
    116470222 (MAPK3)
   04912 GnRH signaling pathway
    116470222 (MAPK3)
   04915 Estrogen signaling pathway
    116470222 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    116470222 (MAPK3)
   04917 Prolactin signaling pathway
    116470222 (MAPK3)
   04921 Oxytocin signaling pathway
    116470222 (MAPK3)
   04926 Relaxin signaling pathway
    116470222 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    116470222 (MAPK3)
   04919 Thyroid hormone signaling pathway
    116470222 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    116470222 (MAPK3)
   04916 Melanogenesis
    116470222 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    116470222 (MAPK3)
   04270 Vascular smooth muscle contraction
    116470222 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    116470222 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    116470222 (MAPK3)
   04725 Cholinergic synapse
    116470222 (MAPK3)
   04726 Serotonergic synapse
    116470222 (MAPK3)
   04720 Long-term potentiation
    116470222 (MAPK3)
   04730 Long-term depression
    116470222 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    116470222 (MAPK3)
   04722 Neurotrophin signaling pathway
    116470222 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    116470222 (MAPK3)
   04380 Osteoclast differentiation
    116470222 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    116470222 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116470222 (MAPK3)
   05206 MicroRNAs in cancer
    116470222 (MAPK3)
   05205 Proteoglycans in cancer
    116470222 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    116470222 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    116470222 (MAPK3)
   05203 Viral carcinogenesis
    116470222 (MAPK3)
   05230 Central carbon metabolism in cancer
    116470222 (MAPK3)
   05231 Choline metabolism in cancer
    116470222 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    116470222 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    116470222 (MAPK3)
   05212 Pancreatic cancer
    116470222 (MAPK3)
   05225 Hepatocellular carcinoma
    116470222 (MAPK3)
   05226 Gastric cancer
    116470222 (MAPK3)
   05214 Glioma
    116470222 (MAPK3)
   05216 Thyroid cancer
    116470222 (MAPK3)
   05221 Acute myeloid leukemia
    116470222 (MAPK3)
   05220 Chronic myeloid leukemia
    116470222 (MAPK3)
   05218 Melanoma
    116470222 (MAPK3)
   05211 Renal cell carcinoma
    116470222 (MAPK3)
   05219 Bladder cancer
    116470222 (MAPK3)
   05215 Prostate cancer
    116470222 (MAPK3)
   05213 Endometrial cancer
    116470222 (MAPK3)
   05224 Breast cancer
    116470222 (MAPK3)
   05223 Non-small cell lung cancer
    116470222 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    116470222 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    116470222 (MAPK3)
   05161 Hepatitis B
    116470222 (MAPK3)
   05160 Hepatitis C
    116470222 (MAPK3)
   05171 Coronavirus disease - COVID-19
    116470222 (MAPK3)
   05164 Influenza A
    116470222 (MAPK3)
   05163 Human cytomegalovirus infection
    116470222 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    116470222 (MAPK3)
   05165 Human papillomavirus infection
    116470222 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    116470222 (MAPK3)
   05135 Yersinia infection
    116470222 (MAPK3)
   05133 Pertussis
    116470222 (MAPK3)
   05152 Tuberculosis
    116470222 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    116470222 (MAPK3)
   05140 Leishmaniasis
    116470222 (MAPK3)
   05142 Chagas disease
    116470222 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    116470222 (MAPK3)
   05020 Prion disease
    116470222 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    116470222 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    116470222 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    116470222 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    116470222 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    116470222 (MAPK3)
   04934 Cushing syndrome
    116470222 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    116470222 (MAPK3)
   01524 Platinum drug resistance
    116470222 (MAPK3)
   01522 Endocrine resistance
    116470222 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hmh01001]
    116470222 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hmh03036]
    116470222 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hmh04147]
    116470222 (MAPK3)
Enzymes [BR:hmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     116470222 (MAPK3)
Protein kinases [BR:hmh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   116470222 (MAPK3)
Chromosome and associated proteins [BR:hmh03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     116470222 (MAPK3)
Exosome [BR:hmh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   116470222 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 116470222
NCBI-ProteinID: XP_032011682
LinkDB
Position
Unknown
AA seq 379 aa
MAAAAAQGGGGGEPRRAEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERL
KELIFQETARFQPGVLEAP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcggcggcagcggctcaggggggcgggggcggggagccccggagagccgagggggtc
ggcccgggggtcccgggggaggtggagatggtgaaggggcagccgttcgacgtgggcccg
cgctacacgcagttgcagtacatcggcgagggcgcttacggcatggtcagctcggcctat
gaccacgtgcgcaagactcgcgtggccatcaagaagatcagccccttcgagcatcagacc
tactgccagcgcacgctccgggagatccagatcctgctgcgcttccgccatgagaatgtc
atcggcatccgagacattctgcgggcgtccaccctggaagccatgagggatgtctacatt
gtgcaggacctgatggagactgacctgtacaagttgctgaaaagccagcagctgagcaat
gaccatatctgctacttcctctaccagatcctgcggggcctcaagtacatccactccgcc
aatgtgctccaccgagatctaaagccctccaacctgctcatcaacaccacctgcgacctt
aagatttgcgatttcggcctggcccggattgccgatcctgagcatgaccacaccggcttc
ctgacggagtatgtggctacgcgctggtaccgggccccagagatcatgctgaactccaag
ggctataccaagtccatcgacatctggtctgtgggctgcattctagctgagatgctctct
aaccggcccatcttccctggcaagcactacctggatcagctcaaccacattctgggcatc
ctgggctccccatcccaggaggacctgaattgcatcatcaacatgaaggcccgaaactac
ctacagtctctgccctccaagaccaaggtggcttgggccaagcttttccccaagtcagac
tccaaagcccttgatctgctggaccggatgttaacctttaaccccaataaacggatcaca
gtggaggaagcgctggctcacccctacctggagcagtactatgacccgacggatgagcca
gtggccgaggagcccttcaccttcgccatggagctggatgacctacctaaggagcggctg
aaggagctcatcttccaggagacagcacgcttccagcccggagtgctggaggccccctag

DBGET integrated database retrieval system