Hylobates moloch (silvery gibbon): 116470506 Help Entry 116470506         CDS       T08803                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04015   Rap1 signaling pathway hmh04810   Regulation of actin cytoskeleton hmh05014   Amyotrophic lateral sclerosis hmh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     116470506 (PFN3)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     116470506 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hmh04131]     116470506 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hmh04812]     116470506 (PFN3)    04147 Exosome [BR:hmh04147]     116470506 (PFN3) Membrane trafficking [BR:hmh04131]  Others   Actin-binding proteins    Others     116470506 (PFN3) Cytoskeleton proteins [BR:hmh04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      116470506 (PFN3) Exosome [BR:hmh04147]  Exosomal proteins   Proteins found in most exosomes    116470506 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  116470506 NCBI-ProteinID:  XP_032011898 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRRIFL QAGLSVGGRRCCVIRDHLLAEGDGVLDARTKGLDARAVCVGHAPRALLVLMGRRGVHGGI LNKKVHELIRGLRMQGA NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaaggtctacatcagtgcggtgctgcgggaccagcgcatcgacgacgtg gccatcgtgggccatgcggacaacagctgcgtgtgggcttcgcggcccgggggcctgctg gcggccatctcgccgcaggaggtgggcgtgctcacggggccggacaggcgcatcttcctg caggcgggcctgagcgtggggggccgccgctgctgcgtcatccgcgaccacctgctggcc gagggcgacggcgtgctggacgcacgcaccaaggggctggacgcgcgcgccgtgtgcgtg ggccatgcgccccgcgcgctcctggtgctcatgggccgacgcggcgtccatgggggcatc ctcaacaagaaggtgcacgaactcatacgcgggctgcgcatgcagggcgcctag

DBGET integrated database retrieval system