Hylobates moloch (silvery gibbon): 116470839 Help Entry 116470839         CDS       T08803                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04060   Cytokine-cytokine receptor interaction hmh04630   JAK-STAT signaling pathway hmh04640   Hematopoietic cell lineage hmh04657   IL-17 signaling pathway hmh04658   Th1 and Th2 cell differentiation hmh04660   T cell receptor signaling pathway hmh04664   Fc epsilon RI signaling pathway hmh04672   Intestinal immune network for IgA production hmh05200   Pathways in cancer hmh05310   Asthma hmh05320   Autoimmune thyroid disease hmh05321   Inflammatory bowel disease hmh05330   Allograft rejection Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     116470839 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116470839 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     116470839 (IL5)    04660 T cell receptor signaling pathway     116470839 (IL5)    04658 Th1 and Th2 cell differentiation     116470839 (IL5)    04657 IL-17 signaling pathway     116470839 (IL5)    04664 Fc epsilon RI signaling pathway     116470839 (IL5)    04672 Intestinal immune network for IgA production     116470839 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116470839 (IL5)   09163 Immune disease    05310 Asthma     116470839 (IL5)    05320 Autoimmune thyroid disease     116470839 (IL5)    05321 Inflammatory bowel disease     116470839 (IL5)    05330 Allograft rejection     116470839 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hmh04052]     116470839 (IL5)    00536 Glycosaminoglycan binding proteins [BR:hmh00536]     116470839 (IL5) Cytokines and neuropeptides [BR:hmh04052]  Cytokines   Interleukins    116470839 (IL5) Glycosaminoglycan binding proteins [BR:hmh00536]  Heparan sulfate / Heparin   Cytokines    116470839 (IL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL5 DUF6034 Motif Other DBs NCBI-GeneID:  116470839 NCBI-ProteinID:  XP_032012367 LinkDB All DBs Position Unknown AA seq 134 aa AA seqDB search MRMLLHLSLLALGAAYVYAIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPAHKNH QLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKRKCGEERRRVNQFLDYLQ EFLGVMNTEWIIES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgaggatgcttctgcatttgagtttgctagctcttggagctgcctatgtgtatgccatc cccacagaaattcccacaagtgcactggtgaaagagactttggcactgctttctactcat cgaactctgctgatagccaatgagactctgaggattcctgttcctgcacataaaaatcac caactgtgcactgaagaaatctttcagggaataggcacactggagagtcaaactgtgcaa gggggtactgtggaaagactattcaaaaacttgtctttaataaagaaatacattgacggc caaaaaagaaagtgtggagaagaaagacggagagtaaaccaattcctagactacctgcaa gagtttcttggtgtaatgaacaccgagtggataatagaaagttga

DBGET integrated database retrieval system