KEGG   Hylobates moloch (silvery gibbon): 116472788
Entry
116472788         CDS       T08803                                 
Symbol
KRAS
Name
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
hmh  Hylobates moloch (silvery gibbon)
Pathway
hmh01521  EGFR tyrosine kinase inhibitor resistance
hmh01522  Endocrine resistance
hmh04010  MAPK signaling pathway
hmh04012  ErbB signaling pathway
hmh04014  Ras signaling pathway
hmh04015  Rap1 signaling pathway
hmh04062  Chemokine signaling pathway
hmh04068  FoxO signaling pathway
hmh04071  Sphingolipid signaling pathway
hmh04072  Phospholipase D signaling pathway
hmh04137  Mitophagy - animal
hmh04140  Autophagy - animal
hmh04150  mTOR signaling pathway
hmh04151  PI3K-Akt signaling pathway
hmh04210  Apoptosis
hmh04211  Longevity regulating pathway
hmh04213  Longevity regulating pathway - multiple species
hmh04218  Cellular senescence
hmh04360  Axon guidance
hmh04370  VEGF signaling pathway
hmh04371  Apelin signaling pathway
hmh04540  Gap junction
hmh04550  Signaling pathways regulating pluripotency of stem cells
hmh04625  C-type lectin receptor signaling pathway
hmh04650  Natural killer cell mediated cytotoxicity
hmh04660  T cell receptor signaling pathway
hmh04662  B cell receptor signaling pathway
hmh04664  Fc epsilon RI signaling pathway
hmh04714  Thermogenesis
hmh04720  Long-term potentiation
hmh04722  Neurotrophin signaling pathway
hmh04725  Cholinergic synapse
hmh04726  Serotonergic synapse
hmh04730  Long-term depression
hmh04810  Regulation of actin cytoskeleton
hmh04910  Insulin signaling pathway
hmh04912  GnRH signaling pathway
hmh04914  Progesterone-mediated oocyte maturation
hmh04915  Estrogen signaling pathway
hmh04916  Melanogenesis
hmh04917  Prolactin signaling pathway
hmh04919  Thyroid hormone signaling pathway
hmh04921  Oxytocin signaling pathway
hmh04926  Relaxin signaling pathway
hmh04929  GnRH secretion
hmh04933  AGE-RAGE signaling pathway in diabetic complications
hmh04935  Growth hormone synthesis, secretion and action
hmh04960  Aldosterone-regulated sodium reabsorption
hmh05010  Alzheimer disease
hmh05022  Pathways of neurodegeneration - multiple diseases
hmh05034  Alcoholism
hmh05160  Hepatitis C
hmh05161  Hepatitis B
hmh05163  Human cytomegalovirus infection
hmh05165  Human papillomavirus infection
hmh05166  Human T-cell leukemia virus 1 infection
hmh05167  Kaposi sarcoma-associated herpesvirus infection
hmh05170  Human immunodeficiency virus 1 infection
hmh05200  Pathways in cancer
hmh05203  Viral carcinogenesis
hmh05205  Proteoglycans in cancer
hmh05206  MicroRNAs in cancer
hmh05207  Chemical carcinogenesis - receptor activation
hmh05208  Chemical carcinogenesis - reactive oxygen species
hmh05210  Colorectal cancer
hmh05211  Renal cell carcinoma
hmh05212  Pancreatic cancer
hmh05213  Endometrial cancer
hmh05214  Glioma
hmh05215  Prostate cancer
hmh05216  Thyroid cancer
hmh05218  Melanoma
hmh05219  Bladder cancer
hmh05220  Chronic myeloid leukemia
hmh05221  Acute myeloid leukemia
hmh05223  Non-small cell lung cancer
hmh05224  Breast cancer
hmh05225  Hepatocellular carcinoma
hmh05226  Gastric cancer
hmh05230  Central carbon metabolism in cancer
hmh05231  Choline metabolism in cancer
hmh05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hmh05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hmh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    116472788 (KRAS)
   04012 ErbB signaling pathway
    116472788 (KRAS)
   04014 Ras signaling pathway
    116472788 (KRAS)
   04015 Rap1 signaling pathway
    116472788 (KRAS)
   04370 VEGF signaling pathway
    116472788 (KRAS)
   04371 Apelin signaling pathway
    116472788 (KRAS)
   04068 FoxO signaling pathway
    116472788 (KRAS)
   04072 Phospholipase D signaling pathway
    116472788 (KRAS)
   04071 Sphingolipid signaling pathway
    116472788 (KRAS)
   04151 PI3K-Akt signaling pathway
    116472788 (KRAS)
   04150 mTOR signaling pathway
    116472788 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    116472788 (KRAS)
   04137 Mitophagy - animal
    116472788 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    116472788 (KRAS)
   04218 Cellular senescence
    116472788 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    116472788 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    116472788 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    116472788 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    116472788 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    116472788 (KRAS)
   04660 T cell receptor signaling pathway
    116472788 (KRAS)
   04662 B cell receptor signaling pathway
    116472788 (KRAS)
   04664 Fc epsilon RI signaling pathway
    116472788 (KRAS)
   04062 Chemokine signaling pathway
    116472788 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    116472788 (KRAS)
   04929 GnRH secretion
    116472788 (KRAS)
   04912 GnRH signaling pathway
    116472788 (KRAS)
   04915 Estrogen signaling pathway
    116472788 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    116472788 (KRAS)
   04917 Prolactin signaling pathway
    116472788 (KRAS)
   04921 Oxytocin signaling pathway
    116472788 (KRAS)
   04926 Relaxin signaling pathway
    116472788 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    116472788 (KRAS)
   04919 Thyroid hormone signaling pathway
    116472788 (KRAS)
   04916 Melanogenesis
    116472788 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    116472788 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    116472788 (KRAS)
   04726 Serotonergic synapse
    116472788 (KRAS)
   04720 Long-term potentiation
    116472788 (KRAS)
   04730 Long-term depression
    116472788 (KRAS)
   04722 Neurotrophin signaling pathway
    116472788 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    116472788 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    116472788 (KRAS)
   04213 Longevity regulating pathway - multiple species
    116472788 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    116472788 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116472788 (KRAS)
   05206 MicroRNAs in cancer
    116472788 (KRAS)
   05205 Proteoglycans in cancer
    116472788 (KRAS)
   05207 Chemical carcinogenesis - receptor activation
    116472788 (KRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    116472788 (KRAS)
   05203 Viral carcinogenesis
    116472788 (KRAS)
   05230 Central carbon metabolism in cancer
    116472788 (KRAS)
   05231 Choline metabolism in cancer
    116472788 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    116472788 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    116472788 (KRAS)
   05212 Pancreatic cancer
    116472788 (KRAS)
   05225 Hepatocellular carcinoma
    116472788 (KRAS)
   05226 Gastric cancer
    116472788 (KRAS)
   05214 Glioma
    116472788 (KRAS)
   05216 Thyroid cancer
    116472788 (KRAS)
   05221 Acute myeloid leukemia
    116472788 (KRAS)
   05220 Chronic myeloid leukemia
    116472788 (KRAS)
   05218 Melanoma
    116472788 (KRAS)
   05211 Renal cell carcinoma
    116472788 (KRAS)
   05219 Bladder cancer
    116472788 (KRAS)
   05215 Prostate cancer
    116472788 (KRAS)
   05213 Endometrial cancer
    116472788 (KRAS)
   05224 Breast cancer
    116472788 (KRAS)
   05223 Non-small cell lung cancer
    116472788 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    116472788 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    116472788 (KRAS)
   05161 Hepatitis B
    116472788 (KRAS)
   05160 Hepatitis C
    116472788 (KRAS)
   05163 Human cytomegalovirus infection
    116472788 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    116472788 (KRAS)
   05165 Human papillomavirus infection
    116472788 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    116472788 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    116472788 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    116472788 (KRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    116472788 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    116472788 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    116472788 (KRAS)
   01522 Endocrine resistance
    116472788 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hmh04131]
    116472788 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hmh04031]
    116472788 (KRAS)
Membrane trafficking [BR:hmh04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    116472788 (KRAS)
GTP-binding proteins [BR:hmh04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    116472788 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin
Other DBs
NCBI-GeneID: 116472788
NCBI-ProteinID: XP_032015749
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIIM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcattttgtggacgaatatgatccaacaatagaggattcctac
aggaagcaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaatt
aaaagagttaaggactctgaagatgtacctatggtcctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatggaattcct
tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattataatgtaa

DBGET integrated database retrieval system