Hylobates moloch (silvery gibbon): 116473478 Help Entry 116473478         CDS       T08803                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04014   Ras signaling pathway hmh04015   Rap1 signaling pathway hmh04022   cGMP-PKG signaling pathway hmh04024   cAMP signaling pathway hmh04062   Chemokine signaling pathway hmh04071   Sphingolipid signaling pathway hmh04072   Phospholipase D signaling pathway hmh04081   Hormone signaling hmh04144   Endocytosis hmh04150   mTOR signaling pathway hmh04270   Vascular smooth muscle contraction hmh04310   Wnt signaling pathway hmh04350   TGF-beta signaling pathway hmh04360   Axon guidance hmh04510   Focal adhesion hmh04520   Adherens junction hmh04530   Tight junction hmh04611   Platelet activation hmh04621   NOD-like receptor signaling pathway hmh04625   C-type lectin receptor signaling pathway hmh04660   T cell receptor signaling pathway hmh04670   Leukocyte transendothelial migration hmh04722   Neurotrophin signaling pathway hmh04810   Regulation of actin cytoskeleton hmh04921   Oxytocin signaling pathway hmh04928   Parathyroid hormone synthesis, secretion and action hmh04972   Pancreatic secretion hmh05100   Bacterial invasion of epithelial cells hmh05132   Salmonella infection hmh05133   Pertussis hmh05135   Yersinia infection hmh05152   Tuberculosis hmh05163   Human cytomegalovirus infection hmh05200   Pathways in cancer hmh05203   Viral carcinogenesis hmh05205   Proteoglycans in cancer hmh05206   MicroRNAs in cancer hmh05210   Colorectal cancer hmh05417   Lipid and atherosclerosis hmh05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     116473478 (RHOA)    04015 Rap1 signaling pathway     116473478 (RHOA)    04310 Wnt signaling pathway     116473478 (RHOA)    04350 TGF-beta signaling pathway     116473478 (RHOA)    04072 Phospholipase D signaling pathway     116473478 (RHOA)    04071 Sphingolipid signaling pathway     116473478 (RHOA)    04024 cAMP signaling pathway     116473478 (RHOA)    04022 cGMP-PKG signaling pathway     116473478 (RHOA)    04150 mTOR signaling pathway     116473478 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     116473478 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     116473478 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     116473478 (RHOA)    04660 T cell receptor signaling pathway     116473478 (RHOA)    04670 Leukocyte transendothelial migration     116473478 (RHOA)    04062 Chemokine signaling pathway     116473478 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     116473478 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     116473478 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     116473478 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     116473478 (RHOA)   09158 Development and regeneration    04360 Axon guidance     116473478 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116473478 (RHOA)    05206 MicroRNAs in cancer     116473478 (RHOA)    05205 Proteoglycans in cancer     116473478 (RHOA)    05203 Viral carcinogenesis     116473478 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     116473478 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     116473478 (RHOA)   09171 Infectious disease: bacterial    05135 Yersinia infection     116473478 (RHOA)    05133 Pertussis     116473478 (RHOA)    05152 Tuberculosis     116473478 (RHOA)    05100 Bacterial invasion of epithelial cells     116473478 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116473478 (RHOA)    05418 Fluid shear stress and atherosclerosis     116473478 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hmh04131]     116473478 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hmh04147]     116473478 (RHOA)    04031 GTP-binding proteins [BR:hmh04031]     116473478 (RHOA) Membrane trafficking [BR:hmh04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     116473478 (RHOA) Exosome [BR:hmh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116473478 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    116473478 (RHOA)   Exosomal proteins of colorectal cancer cells    116473478 (RHOA)   Exosomal proteins of bladder cancer cells    116473478 (RHOA) GTP-binding proteins [BR:hmh04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     116473478 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  116473478 NCBI-ProteinID:  XP_032017456 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggaaagacatgc ttgctcatagtcttcagcaaggaccagttcccagaggtgtatgtgcccacagtgtttgag aactatgtggcagatatcgaggtggatggaaagcaggtagagttggctttgtgggacaca gctgggcaggaagattatgatcgcctgaggcccctctcctacccagataccgatgttata ctgatgtgtttttccatcgacagtcctgatagtttagaaaacataccagaaaagtggacc ccggaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaataagaaggat cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtgaaa cctgaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagagaggtttttgaaatggctacgagagctgctctgcaa gctagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system