Hylobates moloch (silvery gibbon): 116473795 Help Entry 116473795         CDS       T08803                                  Name (RefSeq) protein S100-A10-like   KO K17274   protein S100-A10 Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04382   Cornified envelope formation hmh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hmh00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     116473795  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116473795  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hmh04147]     116473795 Exosome [BR:hmh04147]  Exosomal proteins   Exosomal proteins of microglial cells    116473795 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  116473795 NCBI-ProteinID:  XP_032614288 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGNK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacacgccatggaaaccatgatgtttacatttcacaaattcgct ggggataaaggctacttaacaaaggaggacctgagagtactcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccctctggctgtggacaaaataatgaaggacctggac cagtgcagagatggcaaagtgggcttccagagcttcttttccctaattgcaggcctcacc attgcatgcaatgactattttgtagtacacatgaagcagaagggaaacaagtag

DBGET integrated database retrieval system