Hylobates moloch (silvery gibbon): 116474220 Help Entry 116474220         CDS       T08803                                  Name (RefSeq) metallothionein-1E-like   KO K14739   metallothionein 1/2 Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04978   Mineral absorption Brite KEGG Orthology (KO) [BR:hmh00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     116474220  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:hmh03019]     116474220    03029 Mitochondrial biogenesis [BR:hmh03029]     116474220 Messenger RNA biogenesis [BR:hmh03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      116474220 Mitochondrial biogenesis [BR:hmh03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     116474220 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  116474220 NCBI-ProteinID:  XP_032617328 LinkDB All DBs Position Unknown AA seq 60 aa AA seqDB search MDPNGSCTTGGSCACAGSCKCKECKCTSCKKSCSCCPVGCAKCAQGCICKGATEKCSCCA NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggaccccaatggctcctgcaccactggcggctcctgcgcctgtgctggctcctgcaaa tgcaaagagtgcaaatgcacctcctgcaagaagagctgctcctgctgccccgtgggctgt gccaagtgtgcccagggctgcatctgcaaaggggcaacggagaagtgcagctgctgtgcc tga

DBGET integrated database retrieval system