Hylobates moloch (silvery gibbon): 116475348 Help Entry 116475348         CDS       T08803                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04010   MAPK signaling pathway hmh04020   Calcium signaling pathway hmh04022   cGMP-PKG signaling pathway hmh04114   Oocyte meiosis hmh04218   Cellular senescence hmh04310   Wnt signaling pathway hmh04360   Axon guidance hmh04370   VEGF signaling pathway hmh04380   Osteoclast differentiation hmh04625   C-type lectin receptor signaling pathway hmh04650   Natural killer cell mediated cytotoxicity hmh04658   Th1 and Th2 cell differentiation hmh04659   Th17 cell differentiation hmh04660   T cell receptor signaling pathway hmh04662   B cell receptor signaling pathway hmh04720   Long-term potentiation hmh04724   Glutamatergic synapse hmh04921   Oxytocin signaling pathway hmh04922   Glucagon signaling pathway hmh04924   Renin secretion hmh05010   Alzheimer disease hmh05014   Amyotrophic lateral sclerosis hmh05020   Prion disease hmh05022   Pathways of neurodegeneration - multiple diseases hmh05031   Amphetamine addiction hmh05152   Tuberculosis hmh05163   Human cytomegalovirus infection hmh05166   Human T-cell leukemia virus 1 infection hmh05167   Kaposi sarcoma-associated herpesvirus infection hmh05170   Human immunodeficiency virus 1 infection hmh05235   PD-L1 expression and PD-1 checkpoint pathway in cancer hmh05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116475348 (PPP3R2)    04310 Wnt signaling pathway     116475348 (PPP3R2)    04370 VEGF signaling pathway     116475348 (PPP3R2)    04020 Calcium signaling pathway     116475348 (PPP3R2)    04022 cGMP-PKG signaling pathway     116475348 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     116475348 (PPP3R2)    04218 Cellular senescence     116475348 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116475348 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     116475348 (PPP3R2)    04660 T cell receptor signaling pathway     116475348 (PPP3R2)    04658 Th1 and Th2 cell differentiation     116475348 (PPP3R2)    04659 Th17 cell differentiation     116475348 (PPP3R2)    04662 B cell receptor signaling pathway     116475348 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     116475348 (PPP3R2)    04921 Oxytocin signaling pathway     116475348 (PPP3R2)    04924 Renin secretion     116475348 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     116475348 (PPP3R2)    04720 Long-term potentiation     116475348 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     116475348 (PPP3R2)    04380 Osteoclast differentiation     116475348 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     116475348 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     116475348 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     116475348 (PPP3R2)    05163 Human cytomegalovirus infection     116475348 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     116475348 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     116475348 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     116475348 (PPP3R2)    05014 Amyotrophic lateral sclerosis     116475348 (PPP3R2)    05020 Prion disease     116475348 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     116475348 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     116475348 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116475348 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:hmh01009]     116475348 (PPP3R2) Protein phosphatases and associated proteins [BR:hmh01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      116475348 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EH EF-hand_9 YtfJ_HI0045 Motif Other DBs NCBI-GeneID:  116475348 NCBI-ProteinID:  XP_058301205 LinkDB All DBs Position Unknown AA seq 173 aa AA seqDB search MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRR VIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLK MMVGNNLMDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atgtccacaatgggaaacgaggccagttacccggcggagatgtgctcccactttgacaat gatgaaattaaaaggctgggcaggaggtttaagaagttggacttggacaaatcagggtct ctgagcgtggaggagttcatgtccctgccggagctgcgccacaacccgttggtgcggcga gtgatcgacgtcttcgacaccgacggtgatggagaagtggacttcaaggaattcatcctg gggacctcccagttcagcgtcaagggcgacgaggagcagaagttgaggtttgcgttcagc atttacgacatggataaagatggctatatttccaacggggagctcttccaggtgctgaag atgatggtgggcaacaacctgatggactggcagctccagcagctggtcgacaaaaccatc atcatcctggacaaggatggcgatgggaagatatcctttgaggaattcagtgctgtggtc agagacctggagatccacaagaagctggtcctcatcgtgtga

DBGET integrated database retrieval system