Hylobates moloch (silvery gibbon): 116478633 Help Entry 116478633         CDS       T08803                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04140   Autophagy - animal hmh04144   Endocytosis hmh04152   AMPK signaling pathway hmh04530   Tight junction hmh04972   Pancreatic secretion hmh05014   Amyotrophic lateral sclerosis hmh05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     116478633 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     116478633 (RAB8A)    04140 Autophagy - animal     116478633 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     116478633 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     116478633 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     116478633 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     116478633 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hmh04131]     116478633 (RAB8A)    03036 Chromosome and associated proteins [BR:hmh03036]     116478633 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hmh04147]     116478633 (RAB8A)    04031 GTP-binding proteins [BR:hmh04031]     116478633 (RAB8A) Membrane trafficking [BR:hmh04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     116478633 (RAB8A)  Autophagy   Other autophagy associated proteins     116478633 (RAB8A) Chromosome and associated proteins [BR:hmh03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     116478633 (RAB8A) Exosome [BR:hmh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116478633 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    116478633 (RAB8A)   Exosomal proteins of colorectal cancer cells    116478633 (RAB8A) GTP-binding proteins [BR:hmh04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     116478633 (RAB8A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Septin AAA_7 Motif Other DBs NCBI-GeneID:  116478633 NCBI-ProteinID:  XP_032025908 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSNQGVKITPDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactccacttttatctccacc ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaaattgcag atatgggacacagccggtcaggaacggtttcggacgatcacaacggcctactacaggggc gcaatgggcatcatgctggtctacgacatcaccaatgagaagtccttcgacaacatccgg aactggattcgcaacattgaggagcacgcctctgcagacgtcgaaaagatgatactcggg aacaagtgtgatgtgaatgacaagagacaagtttccaaggaacggggagaaaagctggct ctcgactatggaatcaagttcatggagaccagcgcgaaggccaacatcaacgtggaaaat gcatttttcactctcgccagagacatcaaagcaaaaatggacaaaaaattggaaggcaat agcccccaggggagcaaccagggagtcaaaatcacaccagaccagcagaaaaggagcagc tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system