Hylobates moloch (silvery gibbon): 116479944 Help Entry 116479944         CDS       T08803                                  Symbol IL2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04060   Cytokine-cytokine receptor interaction hmh04061   Viral protein interaction with cytokine and cytokine receptor hmh04151   PI3K-Akt signaling pathway hmh04625   C-type lectin receptor signaling pathway hmh04630   JAK-STAT signaling pathway hmh04658   Th1 and Th2 cell differentiation hmh04659   Th17 cell differentiation hmh04660   T cell receptor signaling pathway hmh04672   Intestinal immune network for IgA production hmh04940   Type I diabetes mellitus hmh05135   Yersinia infection hmh05142   Chagas disease hmh05162   Measles hmh05166   Human T-cell leukemia virus 1 infection hmh05171   Coronavirus disease - COVID-19 hmh05200   Pathways in cancer hmh05320   Autoimmune thyroid disease hmh05321   Inflammatory bowel disease hmh05330   Allograft rejection hmh05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     116479944 (IL2)    04151 PI3K-Akt signaling pathway     116479944 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116479944 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     116479944 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116479944 (IL2)    04660 T cell receptor signaling pathway     116479944 (IL2)    04658 Th1 and Th2 cell differentiation     116479944 (IL2)    04659 Th17 cell differentiation     116479944 (IL2)    04672 Intestinal immune network for IgA production     116479944 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116479944 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     116479944 (IL2)    05171 Coronavirus disease - COVID-19     116479944 (IL2)    05162 Measles     116479944 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     116479944 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     116479944 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     116479944 (IL2)    05321 Inflammatory bowel disease     116479944 (IL2)    05330 Allograft rejection     116479944 (IL2)    05332 Graft-versus-host disease     116479944 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     116479944 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hmh04052]     116479944 (IL2)    00536 Glycosaminoglycan binding proteins [BR:hmh00536]     116479944 (IL2) Cytokines and neuropeptides [BR:hmh04052]  Cytokines   Interleukins    116479944 (IL2) Glycosaminoglycan binding proteins [BR:hmh00536]  Heparan sulfate / Heparin   Cytokines    116479944 (IL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL2 Plasmid_RAQPRD Motif Other DBs NCBI-GeneID:  116479944 NCBI-ProteinID:  XP_032027759 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MYRMQLLSCIALSLALVTNGAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVQELKGSE TTFMCEYADETATIVEFLNRWITFCQSIISTLT NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcacttgtcacaaatggt gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggat ttacagatgattttgaatggaattaataattacaagaatcccaaactcaccaggatgctc acatttaagttttacatgcccaagaaggccacagaattgaaacatcttcagtgtctagaa gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta agacccagggacttaatcagcaatatcaacgtaatagttcaggaactaaagggatctgaa acaacattcatgtgtgaatatgctgatgagacagcaaccattgtagaatttctgaacaga tggattaccttttgtcaaagcatcatctcaacactgacttga

DBGET integrated database retrieval system