Hylobates moloch (silvery gibbon): 116479954 Help Entry 116479954         CDS       T08803                                  Symbol SST Name (RefSeq) somatostatin   KO K05237   somatostatin Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04024   cAMP signaling pathway hmh04080   Neuroactive ligand-receptor interaction hmh04081   Hormone signaling hmh04935   Growth hormone synthesis, secretion and action hmh04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     116479954 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     116479954 (SST)    04081 Hormone signaling     116479954 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     116479954 (SST)   09154 Digestive system    04971 Gastric acid secretion     116479954 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hmh04052]     116479954 (SST) Cytokines and neuropeptides [BR:hmh04052]  Neuropeptides   GPCR binding    116479954 (SST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  116479954 NCBI-ProteinID:  XP_032027776 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQATDQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggctgcgctgtccatcgtcctggccctgggc ggtgtcaccggcgctccctcggaccccagactccgtcagtttctgcagaagtccctggct gctgccgcagggaagcaggaactggccaagtacttcttggcagagcttctatctgaaccc aaccagacagagaatgatgccctggaacctgaggatctgtcccaggctactgaccaggat gaaatgaggcttgagctgcagagatctgctaactccaacccggctatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagactttcacatcctgttag

DBGET integrated database retrieval system