Hylobates moloch (silvery gibbon): 116481139 Help Entry 116481139         CDS       T08803                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04015   Rap1 signaling pathway hmh04810   Regulation of actin cytoskeleton hmh05014   Amyotrophic lateral sclerosis hmh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     116481139 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     116481139 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116481139 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     116481139 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hmh04131]     116481139 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hmh04812]     116481139 (PFN2)    04147 Exosome [BR:hmh04147]     116481139 (PFN2) Membrane trafficking [BR:hmh04131]  Others   Actin-binding proteins    Others     116481139 (PFN2) Cytoskeleton proteins [BR:hmh04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      116481139 (PFN2) Exosome [BR:hmh04147]  Exosomal proteins   Proteins found in most exosomes    116481139 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  116481139 NCBI-ProteinID:  XP_032029721 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttt cagagcattacgccaatagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcgaagaaatgctcagtgatcagagatagtctatacgtc gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaat gtggctgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system