Hylobates moloch (silvery gibbon): 116481992 Help Entry 116481992         CDS       T08803                                  Name (RefSeq) signal transducer CD24-like   KO K06469   CD24 antigen Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04148   Efferocytosis hmh04640   Hematopoietic cell lineage Brite KEGG Orthology (KO) [BR:hmh00001]  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     116481992  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     116481992  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04090 CD molecules [BR:hmh04090]     116481992    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hmh00537]     116481992 CD molecules [BR:hmh04090]  Proteins   116481992 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hmh00537]  Antigens   116481992 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CD24 Motif Other DBs NCBI-GeneID:  116481992 NCBI-ProteinID:  XP_032030981 LinkDB All DBs Position Unknown AA seq 89 aa AA seqDB search MPRTDGGDVGRAMVARLGLGLLLLALLLPTQIYSNETTPGTTSSNPSHNTSNFGIAPNPT NATTKAAGGALQSTASLFMVSLSLLHLYC NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgccgcgcaccgacggaggggacgtgggcagagcaatggtggctaggctcgggctgggg ctgctgctgctggcactgctcctacccacgcagatttattccaatgaaacaactcctgga acaacttcaagtaacccctcccacaatacttccaactttgggattgccccaaatccaact aatgccaccaccaaggcggctggtggtgccctgcagtcaacagccagtctcttcatggtc tcactctctcttctacatctctactgttaa

DBGET integrated database retrieval system