Hylobates moloch (silvery gibbon): 116809437 Help Entry 116809437         CDS       T08803                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04022   cGMP-PKG signaling pathway hmh04081   Hormone signaling hmh04270   Vascular smooth muscle contraction hmh05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     116809437 (NPPC)   09133 Signaling molecules and interaction    04081 Hormone signaling     116809437 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     116809437 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     116809437 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hmh04052]     116809437 (NPPC) Cytokines and neuropeptides [BR:hmh04052]  Neuropeptides   Unclassified    116809437 (NPPC) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  116809437 NCBI-ProteinID:  XP_032609194 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPGEELAEPQAAGGGQKKGDKAPGGG GANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcatctctcccagctgctggcctgcgccctgctgctcacgctgctctcactccggccc tccgaagccaagcccggggcgccgccgaaggtcccgcgaaccccgccgggagaggagctg gccgagccgcaggctgcgggcggcggtcagaagaagggcgacaaggctcccgggggcggg ggcgccaacctcaagggcgaccggtcgcgactgctccgggacctgcgcgtggacaccaag tcgcgggcagcgtgggcccgccttctgcaagagcaccccaacgcgcgcaaatacaaagga gccaacaagaagggcttgtccaagggctgcttcggcctcaagctggaccgaatcggctcc atgagcggcctgggatgttag

DBGET integrated database retrieval system