Hylobates moloch (silvery gibbon): 116809597 Help Entry 116809597         CDS       T08803                                  Symbol NPY Name (RefSeq) pro-neuropeptide Y   KO K05232   neuropeptide Y Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04024   cAMP signaling pathway hmh04080   Neuroactive ligand-receptor interaction hmh04920   Adipocytokine signaling pathway hmh04923   Regulation of lipolysis in adipocytes hmh05034   Alcoholism Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     116809597 (NPY)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     116809597 (NPY)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     116809597 (NPY)    04920 Adipocytokine signaling pathway     116809597 (NPY)  09160 Human Diseases   09165 Substance dependence    05034 Alcoholism     116809597 (NPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hmh04052]     116809597 (NPY) Cytokines and neuropeptides [BR:hmh04052]  Neuropeptides   GPCR binding    116809597 (NPY) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  116809597 NCBI-ProteinID:  XP_032609324 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT RQRYGKRSSPETLISDLLMRESTENVPRTRLEDPSMW NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgctaggtaacaagcgactggggctgtccggactgaccctcgccctgtccctgctcgtg tgcctgggtgcgctggccgaggcatacccctccaagccagacaacccgggcgaggacgca ccagcggaggacatggccagatactactcggcgctgcgacactacatcaacctcatcacc aggcagagatatggaaaacgatctagcccagagacactgatttccgacctcttgatgaga gaaagcacagaaaatgttcccagaactcggcttgaagacccttcaatgtggtga

DBGET integrated database retrieval system