Hylobates moloch (silvery gibbon): 116812476 Help Entry 116812476         CDS       T08803                                  Name (RefSeq) histone H2A.V isoform X3   KO K11251   histone H2A Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh03082   ATP-dependent chromatin remodeling hmh04217   Necroptosis hmh04613   Neutrophil extracellular trap formation hmh05034   Alcoholism hmh05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:hmh00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     116812476  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     116812476  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     116812476  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     116812476   09165 Substance dependence    05034 Alcoholism     116812476  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hmh03036]     116812476   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hmh04147]     116812476 Chromosome and associated proteins [BR:hmh03036]  Eukaryotic type   Nucleosome assembly factors    Histones     116812476 Exosome [BR:hmh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116812476 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  116812476 NCBI-ProteinID:  XP_032614047 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTA NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggaggcaaagctggaaaggacagtgggaaggccaaggctaaggcagtatctcgc tcacagagagctgggctacagtttcctgtgggccgcatccacagacacttgaagactcgc accacaagccatggaagggtgggtgccactgctgccgtgtacagtgctgcgattctggag tacctcactgcagaggtgctggagctggcaggtaatgcttctaaggatctcaaagtaaag cgtatcactccgcgtcacttgcagcttgcaatccgtggtgatgaagagttggattccctt atcaaggctaccatagctgggggtggtgtgatccctcacatccacaaatctctgattgga aagaagggacagcagaaaactgcttag

DBGET integrated database retrieval system