Hylobates moloch (silvery gibbon): 116812901 Help Entry 116812901         CDS       T08803                                  Symbol CENPS Name (RefSeq) centromere protein S isoform X3   KO K11511   centromere protein S Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:hmh00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     116812901 (CENPS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hmh03036]     116812901 (CENPS)    03400 DNA repair and recombination proteins [BR:hmh03400]     116812901 (CENPS) Chromosome and associated proteins [BR:hmh03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      116812901 (CENPS) DNA repair and recombination proteins [BR:hmh03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      116812901 (CENPS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Histone TFIID-31kDa COMMD1_N DASH_Dad2 Bromo_TP DUF4087 Motif Other DBs NCBI-GeneID:  116812901 NCBI-ProteinID:  XP_032614775 LinkDB All DBs Position Unknown AA seq 138 aa AA seqDB search MEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCEN FAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQINLERKAQKKKKSED GSKNSRQPAEAGVVESEN NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atggaggaggaggcggagaccgaggagcagcagcgattctcttaccaacagaggctaaag gcagcagttcactatactgtgggttgtctttgcgaggaagttgcattggacaaagagatg cagttcagcaaacagaccattgcggccatttcggagttgactttccgacagtgcgaaaat tttgccaaagaccttgaaatgtttgcaagacatgcgaaaagaaccacaattaacactgaa gatgtgaagctcttagccaggaggagtaattcactgctaaaatacatcacagataaaagt gaagagattgctcagattaacctagaacgaaaagcacagaagaaaaagaagtcagaggat ggaagcaaaaattcaaggcagccagcagaggctggagtggtggaaagtgagaattaa

DBGET integrated database retrieval system