Hylobates moloch (silvery gibbon): 116813327 Help Entry 116813327         CDS       T08803                                  Symbol ELOC Name (RefSeq) elongin-C isoform X1   KO K03872   elongin-C Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04066   HIF-1 signaling pathway hmh04120   Ubiquitin mediated proteolysis hmh05170   Human immunodeficiency virus 1 infection hmh05200   Pathways in cancer hmh05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:hmh00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     116813327 (ELOC)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     116813327 (ELOC)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116813327 (ELOC)   09162 Cancer: specific types    05211 Renal cell carcinoma     116813327 (ELOC)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     116813327 (ELOC)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:hmh04121]     116813327 (ELOC)    03400 DNA repair and recombination proteins [BR:hmh03400]     116813327 (ELOC) Ubiquitin system [BR:hmh04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      116813327 (ELOC)    Cul5 complex      116813327 (ELOC) DNA repair and recombination proteins [BR:hmh03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      116813327 (ELOC) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  116813327 NCBI-ProteinID:  XP_032615753 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatggagaggagaaaacctatggtgggtgtgaaggccctgatgccatgtatgtcaaa ttgatatcatctgatggccatgaatttattgtaaaaagagaacatgcattaacatcaggc acgataaaagccatgttaagtggcccaggtcagtttgctgagaacgaaaccaatgaggtc aattttagagagataccttcacatgtgctatcgaaagtatgcatgtattttacgtacaag gttcgctacactaacagctccaccgagattcctgaattcccaattgcacctgaaattgca ctggaactgctgatggctgcgaacttcctagattgttaa

DBGET integrated database retrieval system