Hydrocarboniclastica marina: soil367_06545 Help Entry soil367_06545     CDS       T06192                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hmi  Hydrocarboniclastica marina Pathway hmi01100   Metabolic pathways hmi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hmi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     soil367_06545    00074 Mycolic acid biosynthesis     soil367_06545   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     soil367_06545 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 AMPK_alpha_AID Motif Other DBs NCBI-ProteinID:  QCF25602 UniProt:  A0A4P7XHA1 LinkDB All DBs Position 1463316..1463549 Genome browser AA seq 77 aa AA seqDB search MSTVEERVKKIVCEQLGVKESEVQNTSSFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKLGSVQDAIDYIVAHS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtacagttgaagagcgcgtaaagaagatcgtttgtgaacaactcggcgtaaaggag tccgaggttcagaacacgtcttcttttgtcgaggacctgggcgctgattccctggatacc gtcgaattggtaatggcgcttgaagaggaatttgaaaccgaaattcccgatgaagaagcc gaaaagcttggttctgttcaggatgcaatcgactacatcgtcgcgcacagctga

DBGET integrated database retrieval system