Hydrocarboniclastica marina: soil367_17495 Help Entry soil367_17495     CDS       T06192                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hmi  Hydrocarboniclastica marina Pathway hmi01100   Metabolic pathways hmi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hmi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     soil367_17495 (acpP)    00074 Mycolic acid biosynthesis     soil367_17495 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     soil367_17495 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QCF27570 UniProt:  A0A4V1D961 LinkDB All DBs Position complement(3931157..3931399) Genome browser AA seq 80 aa AA seqDB search MSDIERKIRAIVVEQLNVKPDQVTGEAKLVEDLGADSLDVVELTMALEEVFEITIPDEQA EELVTVDDVRRYLQGAIAAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagtgacattgagcggaaaatccgcgcgattgtagtagaacagcttaacgtcaagccc gaccaggttacgggcgaggcaaagttggtggaggacctgggggcggattccctcgacgtg gtggaactaacgatggcgctggaggaagtgtttgagataaccatccccgacgaacaggcc gaggagctggttacggttgatgacgtgcgacggtacctgcagggcgcgatcgccgccagc tga

DBGET integrated database retrieval system